Cat #:
A-400
Alternative Name APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a
Lyophilized Powder yes
Bioassay Tested
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Natural peptide isolated from Anthopleura elegantissima (Sea anemone).
MW: 4884 Da.
Purity: >98% (HPLC)
Effective concentration 1-5 nM.
Sequence GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ.
Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34, and Cys27-Cys45.
Molecular formula C210H316N62O61S6.
Activity Anthopleurin-C is a potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle1,2. It also modifies the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation2.
References-Activity
- Norton, T.R. (1981) Federation Proc. 40, 21.
- Bruhn, T. et al. (2001) Toxicon 39, 693.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
References - Scientific background
- Norton, T.R. (1981) Federation Proc. 40, 21.
- Bruhn, T. et al. (2001) Toxicon 39, 693.
Scientific background
A potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle.1,2 This toxin was found to modify the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation.2
Effective at concentrations of 1-5 nM in isolated guinea-pig atria.2
Target NaV channels
Net Peptide Content: 100%
Lyophilized Powder
Last update: 02/03/2021
Anthopleurin-C (#A-400) is a highly pure, natural, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Specifications
Scientific Background
Citations
Citations
Related Products
Related Products
Antibodies
- Anti-SCN1A (NaV1.1) Antibody (#ASC-001)
- Guinea pig Anti-SCN1A (NaV1.1) Antibody (#AGP-043)
- Anti-SCN2A (NaV1.2) Antibody (#ASC-002)
- Anti-SCN2A (NaV1.2)-ATTO Fluor-594 Antibody (#ASC-002-AR)
- Anti-SCN3A (NaV1.3) (extracellular) Antibody (#ASC-023)
- Anti-NaV1.7 (SCN9A) Antibody (#ASC-008)
- Anti-NaV1.7 (SCN9A)-ATTO Fluor-633 Antibody (#ASC-008-FR)
- Anti-SCN11A (NaV1.9) Antibody (#ASC-017)
- Anti-Pan NaV Antibody (#ASC-003)
Pharmacological tools
Blockers/Antagonists: peptides/peptide toxins
Blockers/Antagonists: small molecules
Activators/Agonists: peptides/peptide toxins
Activators/Agonists: small molecules
Explorer kits & Research packs
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us