Free shipping starts now, no minimum, no coupons required!

Anthopleurin-C

APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a

A Potent Activator of NaV Channels

Cat #: A-400
Alternative Name APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Natural peptide isolated from Anthopleura elegantissima (Sea anemone).
    MW: 4878 Da
    Purity: >98% (HPLC)
    Effective concentration 1-5 nM
    Sequence GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ
    Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34, and Cys27-Cys45
    Structure
    Molecular formula C210H316N62O61S6
    Activity Anthopleurin-C is a potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle1,2. It also modifies the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation2.
    References-Activity
    1. Norton, T.R. (1981) Federation Proc. 40, 21.
    2. Bruhn, T. et al. (2001) Toxicon 39, 693.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Anthopleurin-C enhances NaV currents in differentiated PC-12 cells.
      Alomone Labs Anthopleurin-C enhances NaV currents in differentiated PC-12 cells.
      Current traces recorded before (red) and during (black) application of 5 nM Anthopleurin-C (#A-400). Holding potential was -120 mV and test pulses to -20 mV were delivered every 10 sec.
    References - Scientific background
    1. Norton, T.R. (1981) Federation Proc. 40, 21.
    2. Bruhn, T. et al. (2001) Toxicon 39, 693.
    Scientific background

    A potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle.1,2 This toxin was found to modify the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation.2

    Effective at concentrations of 1-5 nM in isolated guinea-pig atria.2

    Target NaV channels
    Peptide Content: 100%
    Last update: 08/06/2021

    Anthopleurin-C (#A-400) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information