Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

Anthopleurin-C

APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a
A Potent Activator of NaV Channels
    Cat #: A-400
    Alternative Name APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Natural peptide isolated from Anthopleura elegantissima (Sea anemone).
    MW: 4884 Da.
    Purity: >98% (HPLC)
    Effective concentration 1-5 nM.
    Sequence GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ.
    Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34, and Cys27-Cys45.
    Structure
    • Anthopleurin-C
    Molecular formula C210H316N62O61S6.
    Activity Anthopleurin-C is a potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle1,2. It also modifies the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation2.
    References-Activity
    1. Norton, T.R. (1981) Federation Proc. 40, 21.
    2. Bruhn, T. et al. (2001) Toxicon 39, 693.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Anthopleurin-C
      Alomone Labs Anthopleurin-C enhances NaV currents in differentiated PC-12 cells.
      Current traces recorded before (red) and during (black) application of 5 nM Anthopleurin-C (#A-400). Holding potential was -120 mV and test pulses to -20 mV were delivered every 10 sec.
    References - Scientific background
    1. Norton, T.R. (1981) Federation Proc. 40, 21.
    2. Bruhn, T. et al. (2001) Toxicon 39, 693.
    Scientific background

    A potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle.1,2 This toxin was found to modify the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation.2

    Effective at concentrations of 1-5 nM in isolated guinea-pig atria.2

    Target NaV channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 5 µg free trial sample!
    Last update: 24/01/2020

    Anthopleurin-C (#A-400) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations

    Related Products

    Shipping and Ordering information

    Resources

    Mainstream- Fringe- and Patho- Physiology of Voltage Dependent Na+ (NaV) Channels

    Need Help With This Product?

    Our reagent specialists are to help you find the best product for your application. Please Call or Email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us