Alternative Name APE-2-1, AP-C, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a
Lyophilized Powder Lyophilized Powder
This product is freeze dried. All water molecules have been removed.
Bioassay Tested Bioassay Tested
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Natural peptide isolated from Anthopleura elegantissima (Sea anemone).
MW: 4884 Da.
Purity: >98% (HPLC)
Effective concentration 1-5 nM.
Sequence GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ.
Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34, and Cys27-Cys45.
Molecular formula C210H316N62O61S6.
Activity Anthopleurin-C is a potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle1,2. It also modifies the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation2.
-
- Norton, T.R. (1981) Federation Proc. 40, 21.
- Bruhn, T. et al. (2001) Toxicon 39, 693.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
-
Alomone Labs Anthopleurin-C enhances NaV currents in differentiated PC-12 cells.Current traces recorded before (red) and during (black) application of 5 nM Anthopleurin-C (#A-400). Holding potential was -120 mV and test pulses to -20 mV were delivered every 10 sec.
References - Scientific background
- 1. Norton, T.R. (1981) Federation Proc. 40, 21.
- 2. Bruhn, T. et al. (2001) Toxicon 39, 693.
-
A potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle.1,2 This toxin was found to modify the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation.2
Effective at concentrations of 1-5 nM in isolated guinea-pig atria.2
Target NaV channels
Net Peptide Content: 100%
Lyophilized Powder
Last update: 13/11/2019
Anthopleurin-C (#A-400) is a highly pure, natural, and biologically active peptide toxin.
For research purposes only, not for human use