Certificate of Analysis

Cardiac Kir Channel Antibody Explorer Kit

A Screening Package of Cardiac Kir Channel Antibodies Economically Priced

Cat #: AK-330
Size: 7 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-Kir2.1/KCNJ2 Antibody Cat #: APC-026

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Peptide (C)NGVPESTSTDTPPDIDLHN, corresponding to amino acid residues 392-410 of human Kir2.1 (Accession P48049). Intracellular, C-terminal part.
Rabbit, bovine, pig, guinea pig - identical; rat, mouse - 17/19 amino acid residues identical; chicken - 15/19 amino acid residues identical.

Guinea pig Anti-Kir2.1/KCNJ2 Antibody Cat #: AGP-044

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: WB Reactivity: H, M, R
Peptide (C)NGVPESTSTDTPPDIDLHN, corresponding to amino acid residues 392-410 of human Kir2.1 (Accession P48049). Intracellular, C-terminus.
Rabbit, bovine, pig, guinea pig - identical; rat, mouse - 17/19 amino acid residues identical; chicken - 15/19 amino acid residues identical.

Anti-Kir2.2 (KCNJ12) Antibody Cat #: APC-042

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Peptide (C)EVATDRDGRSPQPEHDFDR, corresponding to amino acid residues 391-409 of rat Kir2.2 (Accession P52188). Intracellular, C-terminal part.
Mouse identical or 16/19 amino acid residues identical; human 13/19 amino acid residues identical.

Anti-GIRK1 (Kir3.1) Antibody Cat #: APC-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250). Intracellular, C-terminus.
Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical.

Mouse Anti-GIRK1 (Kir3.1) (extracellular) Antibody Cat #: ALM-031

Size: 25 µg Host: Mouse Type: Monoclonal Application: IC, IF, LCI, WB Reactivity: H, M
Synthetic peptide mapping to the extracellular loop of human GIRK1 (Accession P48549).

Anti-KCNJ5 (Kir3.4) Antibody Cat #: APC-027

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 (Accession P48548). Intracellular, N-terminus.
Mouse, human, pig - identical.

Anti-Kir6.2 Antibody Cat #: APC-020

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Peptide (C)SVAVAKAKPKFSIS, corresponding to amino acid residues 372-385 of rat Kir6.2 (Accession P70673). Intracellular, C-terminal part.
Mouse - identical; human - 12/14 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

A mouse monoclonal antibody (#ALM-031) and guinea pig polyclonal antibody (#AGP-044) are included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use
Shipping and Ordering information