Free shipping starts now, no minimum, no coupons required!
Home › Products › Neural Signaling › Neurotransmission › Neurotoxins › Anticholinesterase Polypeptide Toxins

Fasciculin-I

Fasciculin-1, Fas-1, Fas1, FAS-I, Toxin TA1

A Potent and Reversible Blocker of Acetylcholinesterase

Cat #: F-650
Alternative Name Fasciculin-1, Fas-1, Fas1, FAS-I, Toxin TA1
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Natural peptide isolated from Dendroaspis angusticeps (Eastern green mamba).
    MW: 6791 Da
    Purity: >99% (HPLC)
    Effective concentration 1-10 nM.
    Sequence TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY.
    Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys59.
    Molecular formula C281H441N87O90S10.
    Activity Fasciculin-I selectively and potently binds and inhibits acetylcholinesterase.
    References-Activity
    1. Anglister, L. et al. (1978) J. Mol. Biol. 125, 293.
    2. Ellman, G.L. et al. (1961) Biochem. Pharmacol. 7, 88.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any conventional buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or six months at -20°C.
    Our bioassay
    • Alomone Labs Fasciculin-I potently inhibits Acetylcholinesterase (AChE) activity.
      Alomone Labs Fasciculin-I potently inhibits Acetylcholinesterase (AChE) activity.
      AChE activity was determined colorimetrically using Ellman's reagent, as production of thiocholine from acetylthiocholine. Absorbance was measured at 405 nm after a 30 min incubation. Normalized activity of 400 mU/ml human AChE, as per cent of control, was plotted against increasing concentrations of Fasciculin-I (#F-650), showing concentration-dependent inhibition with pIC50 ≈ 6.7.
    References - Scientific background
    1. Karlsson, E. et al. (1986) Pharmacol. Ther. 30, 259.
    2. Anglister, L. et al. (1978) J. Mol. Biol. 125, 293.
    3. Ellman, G.L. et al. (1961) Biochem. Pharmacol. 7, 88.
    Scientific background

    Fasciculin-I is a 61 amino acid peptidyl toxin with four disulfide bonds, isolated from the Eastern green mamba (Dendroaspis angusticeps) venom. Fasciculin-I belongs to the three finger toxin family, structurally similar to the short alpha-neurotoxins and cardiotoxins1.

    Fasciculin-I was shown to be a selective, potent, and reversible blocker of the mammalian acetylcholinesterase (AChE) at picomolar concentrations1. Injection of Fasciculin-I to mice causes severe generalized and long-lasting twitch (fasciculation) due to its ability to accumulate acetylcholine at the neuromuscular junction2.

    Peptide Content: 100%
    Lyophilized Powder
    Last update: 13/10/2022

    Fasciculin-I (#F-650) is a highly pure, natural, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us