Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

hERG and hERG-Related Channel Antibody Explorer Kit

A Screening Package of hERG and hERG-Related Channel Antibodies Economically Priced

Cat #: AK-222
Size: 18 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KCNH1 (EAG-1) Antibody Cat #: APC-104

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Peptide GDPAKRKGWARFKDAC, corresponding to amino acid residues 802-817 of rat KCNH1 (Accession Q63472). Intracellular, C-terminus.
Mouse - identical; human -14/16 amino acid residues identical.

KCNH1/EAG-1 Blocking Peptide Cat #: BLP-PC104

Size: 40 µg

Anti-KCNH5 (EAG-2) Antibody Cat #: APC-053

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, R
Peptide (C)EDPKGSDSENSVTKNPLRK, corresponding to amino acid residues 842-860 of rat KCNH5 (Accession Q9EPI9). Intracellular, C-terminus.
Human - 18/19 amino acid residues identical.

KCNH5/EAG-2 Blocking Peptide Cat #: BLP-PC053

Size: 40 µg

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

KCNH2/HERG Blocking Peptide Cat #: BLP-PC062

Size: 0.12 mg

Anti-KCNH2 (erg1) Antibody Cat #: APC-016

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Peptide (CY)EEL PAGAP ELPQD GPT, corresponding to residues 1122-1137 of rat KV11.1 (erg1) (Accession O08962). Intracellular, C-terminal part.
Mouse - identical; human, dog, rabbit - 14/16 amino acid residues identical.

KCNH2/erg1 Blocking Peptide Cat #: BLP-PC016

Size: 40 µg

Anti-KCNH2 (HERG) (extracellular) Antibody Cat #: APC-109

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, R
Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG) (Accession Q12809). Extracellular, between S1 and S2 domains.
Rat, mouse - 11/16 amino acid residues identical; dog, rabbit - 15/16 amino residues identical.

KCNH2/HERG (extracellular) Blocking Peptide Cat #: BLP-PC109

Size: 40 µg

Anti-KCNH6 (erg2) Antibody Cat #: APC-114

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide TLNFVEFNLEKHRS(C), corresponding to amino acid residues 185-198 of human KV11.2 (erg2) (Accession Q9H252). Intracellular, N-terminal part.
Rat, chicken - identical; mouse - 13/14 amino acid residues identical.

KCNH6/erg2 Blocking Peptide Cat #: BLP-PC114

Size: 40 µg

Anti-KCNH7 (erg3) Antibody Cat #: APC-112

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Peptide CPEFLDLEKSKLKSKE, corresponding to amino acid residues 1108-1123 of rat KV11.3 (erg3) (Accession O54852). Intracellular, C-terminal part.
Human - identical; mouse - 15/16 amino acid residues identical.

KCNH7/erg3 Blocking Peptide Cat #: BLP-PC112

Size: 40 µg

Anti-KV12.1 (KCNH8) Antibody Cat #: APC-113

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: R
Peptide EDKKEDRAKGRSRAG(C), corresponding to amino acid residues 143-157 of rat KCNH8 (Accession Q9QWS8). Intracellular, N-terminal part.
Mouse -14/15 amino acid residues identical; human -13/15 amino acid residues identical.

Kv12.1/KCNH8 Blocking Peptide Cat #: BLP-PC113

Size: 40 µg

Anti-KV12.3 (KCNH4) Antibody Cat #: APC-116

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, R
Peptide CRLNQEISRLNQEVS, corresponding to amino acids 881-895 of rat KCNH4 (Accession Q9R1T9). Intracellular, C-terminal part.
Human - identical.

Kv12.3/KCNH4 Blocking Peptide Cat #: BLP-PC116

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information