Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

KV1.2 (KCNA2) Channel Basic Research Pack

All You Need for KV1.2 (KCNA2) Channel Research

Cat #: ESB-500
Size: 4 Vials
Form: Lyophilized


Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Mouse, dog, human, - identical.

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: M, R
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Mouse - identical; human - 12/13 amino acid residues identical.

Pharmacological Reagents

Dendrotoxin-K Cat #: D-400

Size: 70 µg MW: 6560 Da Purity: >99% (HPLC) Net peptide content: 100%
Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba).
Effective concentration
100 nM
Dendrotoxin-K is a highly selective blocker of voltage-gated Kchannels (KV1.1 and KV1.2).
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Any aqueous buffer (pH 7.5). Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
One week at 4°C or six months at -20°C.

Tityustoxin-Kα Cat #: STT-360

Size: 0.5 mg MW: 3942 Da Purity: >99% (HPLC) Net peptide content: 100%
Synthetic peptide
Effective concentration
0.5 - 50 nM.
Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.


KV1.2 (KCNA2) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized KV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions

For research purposes only, not for human use
Shipping and Ordering information