Certificate of Analysis

Mitochondrial Ion Channel Antibody Explorer Kit

A Screening Package of Mitochondrial Ion Channel Antibodies Economically Priced
Cat #: AK-535 31 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CLIC4 Antibody Cat #: ACL-024

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide (C)NGLKEEDKEPLIE, corresponding to amino acid residues 8-20 of human CLIC4 (Accession Q9Y696). Intracellular, N-terminus.
Homology
Rat, mouse - identical.

Anti-KCNK9 (TASK-3) (extracellular) Antibody Cat #: APC-044

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, R
Immunogen
Peptide (C)DDYQQLELVILQSEPHR, corresponding to amino acid residues 57-73 of rat KCNK9 (accession number Q9ES08). Extracellular, near the P1 loop.
Homology
Human - 15/17 amino acid residues identical.

Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody Cat #: APC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
Immunogen
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC, corresponding to residues 1097-1196 of mouse KCNMA1 variant 2 (Accession Q08460-2). Intracellular, C-terminus.
Homology
Chicken - 91/99 amino acid residues identical; rabbit - 88/99 amino acid residues identical; turtle - 87/99 amino acid residues identical.

Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody Cat #: AGP-014

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC, corresponding to residues 1097-1196 of mouse KCNMA1 variant 2 (Accession Q08460-2). Intracellular, C-terminus.
Homology
Mouse – 21/21 amino acid residues identical to the canonical sequence (Accession Q08460); rat - 20/21 amino acid residues identical to the canonical sequence (Accession Q62976); human - 19/21 amino acid residues identical to the canonical sequence (Accession Q12791).

Anti-KCNMA1 (KCa1.1) (1184-1200) Antibody Cat #: APC-107

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)STANRPNRPKSRESRDK, corresponding to amino acid residues 1184-1200 of mouse KCNMA1 (Accession number Q08460). Intracellular, C-terminal part.
Homology
Rat - identical; human, bovine, chicken, dog - 16/17 amino acid residues identical.

Anti-KCNMA1 (KCa1.1) (extracellular) Antibody Cat #: APC-151

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IFC, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)DSSNPIES(S)QNFYKD, corresponding to amino acid residues 199-213 of rat KCNMA1 (Accession Q62976). 1st extracellular loop.
Homology
Rat, mouse, human - 14/15 amino acid residues identical.

Anti-KCNN4 (KCa3.1, SK4) Antibody Cat #: APC-064

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide RQVRLKHRKLREQV(C), corresponding to amino acid residues 350-363 of rat KCNN4 (Accession Q9QYW1). Intracellular, C-terminal part.
Homology
Mouse, human, pig - identical.

Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular) Antibody Cat #: ALM-051

Size: 25 µg Host: Mouse Type: Monoclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Synthetic peptide mapping to the 3rd extracellular loop of human KCNN4 (Accession O15554).

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Homology
Rat, rabbit, mouse - identical.

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: AGP-005

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). 1st extracellular loop.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Anti-LETM1 Antibody Cat #: ANT-183

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)KELSKTGDEKYIEE, corresponding to amino acid residues 587-600 of rat LETM1 (Accession Q5XIN6). Intracellular, mitochondrial matrix.
Homology
Mouse –13/14 amino acid residues identical; human – 12/14 amino acid residues identical.

Anti-MCUR1 (CCDC90A) Antibody Cat #: ACC-321

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)GRNALGRLRLGARR, corresponding to amino acid residues 97-110 of mouse mitochondrial calcium uniporter regulator 1 (Accession Q9CXD6). Intracellular loop, mitochondrial matrix.
Homology
Rat - identical; human – no apparent homology.

Anti-MICU1 Antibody Cat #: ACC-322

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)EFERHDPVDGRISER, corresponding to amino acid residues 313-327 of rat MICU1 (Accession Q6P6Q9). Intracellular.
Homology
Mouse - identical; human - 14/15 amino acid residues identical.

Anti-MCU Antibody Cat #: ACC-328

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide CIEQHQLNKERELIER, corresponding to amino acid residues 191-206 of human mitochondrial calcium uniporter (Accession Q8NE86). N-terminus, mitochondrial matrix.
Homology
Rat, mouse – 15/16 amino acid residues identical.

Anti-VDAC Antibody Cat #: AVC-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)DGKNVNAGGHK, corresponding to amino acid residues of 264-274 of rat VDAC1 (Accession Q9Z2L0). Intracellular.
Homology
VDAC1: rat, mouse, human identical; VDAC2: rat, mouse, human - 9/11 amino acid residues identical; VDAC3: rat, mouse - 10/11 amino acid residues identical, human - 9/11 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A mouse monoclonal antibody (#ALM-051) and guinea pig polyclonal antibodies (#AGP-005 & #AGP-014) are included in this Explorer Kit. Please take into account when reacting with a secondary antibody.