Certificate of Analysis

pH-Sensitive KV Channel Antibody Explorer Kit

A Screening Package of pH-Sensitive KV Channel Antibodies Economically Priced
Cat #: AK-470 20 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Mouse, dog, human, - identical.

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: M, R
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Mouse - identical; human - 12/13 amino acid residues identical.

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Rat, rabbit, mouse - identical.

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Rat, mouse - 12/14 amino acid residues identical.

Anti-KV1.4 Antibody Cat #: APC-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
GGST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

Anti-KV1.4 (extracellular) Antibody Cat #: APC-167

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Peptide (C)GHSRLLNDTSAPHLE, corresponding to amino acid residues 348 - 362 of rat KV1.4 (Accession P15385). 1st extracellular loop.
Mouse – identical; human – 13/15 amino acid residues identical.

Anti-KV1.5 (KCNA5) Antibody Cat #: APC-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence HRETDHEEQAALKEEQGIQRRESGLDTGGQRKVSCSKASFHKTGGPLEST DSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTS RETDL, corresponding to amino acid residues 513-602 of mouse KV1.5 (Accession Q61762). Intracellular, C-terminus.
Rat - 86/90 amino acid residues identical; rabbit - 71/90 amino acid residues identical; human - 70/90 amino acid residues identical; bovine, dog - 66/90 amino acid residues identical.

Anti-KV1.5 (KCNA5) (extracellular) Antibody Cat #: APC-150

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, WB Reactivity: H, R
Peptide (C)DERELLRHPPVP(K), corresponding to amino acid residues 268-279 of rat KV1.5 (Accession P19024). 1st extracellular loop.
Rat - 12/13 amino acid residues identical; human - 11/13 amino acid residues identical; mouse - 9/13 amino acid residues identical.

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

Anti-KCNH2 (HERG) (extracellular) Antibody Cat #: APC-109

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, R
Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG) (Accession Q12809). Extracellular, between S1 and S2 domains.
Rat, mouse - 11/16 amino acid residues identical; dog, rabbit - 15/16 amino residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.