Free shipping starts now, no minimum, no coupons required!

Anti-Syntaxin 1 Antibody

STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Cat #: ANR-002
Alternative Name STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: m, r
May also work in: h*
Immunogen
  • GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A (Accession P32851). Intracellular, N-terminus.
Accession (Uniprot) Number P32851
Gene ID 116470
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Human, mouse- 264/265 amino acid residues identical.
RRID AB_2040224.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.4 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: if, ih, wb
May also work in: ie*, ip*
Western blot
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-Syntaxin 1 Antibody (ANR-002), (1:1000).
    2. Anti-Syntaxin 1 Antibody, preincubated with Syntaxin 1 Blocking Peptide (#BLP-NR002).
Immunohistochemistry
  • Rat brain sections.
References
  1. Jahn, R. and Scheller, R.H. (2006) Nat. Rev. Mol. Cell Biol. 7, 631.
  2. Sudhof, T.C. and Rothman, J.E. (2009) Science 323, 474.
  3. Schiavo, G. et al. (2000) Physiol. Rev. 80, 717.
Scientific background

Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60–70 amino acids that are arranged in heptad repeats1,2.

SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1,2.

SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.

Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1,2.

Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1,2.

Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Last update: 12/08/2021

Alomone Labs is pleased to offer a highly specific antibody directed against the intracellular N-terminal domain of rat Syntaxin 1. Anti-Syntaxin 1 Antibody (#ANR-002) can be used in western blot and immunohistochemical applications, and was designed to recognize Syntaxin 1 from rat, mouse and human samples.

For research purposes only, not for human use

Applications

Citations

Citations
More product citations
  1. Wolf-Goldberg, T. et al. (2006) Mol. Pharmacol. 70, 818.
  2. Aoyagi, K. et al. (2005) J. Biol. Chem. 280, 17346.
  3. Michaelevski, I. et al. (2002) J. Biol. Chem. 277, 34909.
  4. Fili, O. et al. (2001) J. Neurosci. 21, 1964.
  5. Ilouz, N. et al. (1999) J. Biol. Chem. 274, 29519.
  6. Macleod, G.T. et al. (1999) J. Neurophysiol. 82, 1133.

Specifications

Scientific Background

Shipping and Ordering information