Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Ceratotoxin-2

β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2

A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels

Cat #: STC-100
Alternative Name β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4093 Da
    Purity: >98% (HPLC)
    Effective concentration 5 nM - 2 µM.
    Sequence DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys22, Cys16-Cys29. Leu33 - C-terminal amidation.
    Structure
    Molecular formula C177H260N52O49S6.
    Activity Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.
    References-Activity
    1. Bosmans, F. et al. (2006) Mol. Pharmacol.  69, 419.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Ceratotoxin-2 inhibits NaV1.2 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Ceratotoxin-2 inhibits NaV1.2 channels heterologously expressed in Xenopus oocytes.
      NaV1.2 currents were elicited by application of voltage step of 100 ms from -80 mV (holding potential) to 10 mV. A. Time course of channel activity (peak current amplitude) before (black) and during (green) application of 200 nM Ceratotoxin-2 (#STC-100). B. Example of superimposed current traces before (black) and during (green) application of the toxin, taken from the experiment in A.
    References - Scientific background
    1. Bosmans, F. et al. (2006) Mol. Pharmacol.  69, 419.
    Scientific background

    Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.

    Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.

    Target NaV channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 08/06/2021

    Ceratotoxin-2 (#STC-100) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations

    Related Products

    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us