Free shipping starts now, no minimum, no coupons required!

human Galanin

A Non-Selective and Potent Agonist of Galanin Receptors

Cat #: GPG-050
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3157 Da
    Purity: ≥98% (HPLC)
    Effective concentration 1-10 nM.
    Sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS.
    Structure
    Molecular formula C139H210N42O43.
    CAS No.: 119418-04-1
    Activity Galanin receptor agonist1.
    References-Activity
    1. Schmidt W.E. et al. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 11435.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in water. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs human Galanin activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Alomone Labs human Galanin activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Dose response of normalized activation of the Galanin 2 receptor-mediated Ca2+ mobilization, evoked by human Galanin (#GPG-050). Ca2+ response was detected by measuring aequorin-derived fluorescence following application of human Galanin at different concentrations. The EC50 measured for human Galanin is 5.76 nM.
    References - Scientific background
    1. Schmidt W.E. et al. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 11435.
    2. Zhang, M.L. et al. (2017) Sci. Rep. 7, 45930.
    Scientific background

    Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. In human, Galanin is a C-terminal-amidated 30-residue peptide deriving its name from the N-terminal glycine and C-terminal alanine residue1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.

    Galanin is widely distributed through the central and peripheral nervous system and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal glands. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception of the central nervous system, at spinal cord levels and in the brain2.

    Target Galanin receptors
    Peptide Content: 100%
    Last update: 02/01/2022

    human Galanin (#GPG-050) is a highly pure, synthetic, and biologically active peptide.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Shipping and Ordering information