Free shipping starts now, no minimum, no coupons required!
Home › Products › G-Protein Coupled Receptors › Galanin Receptors › Agonists

human GALP (3-32)

Galanin-like peptide (3-32)

A Non-Selective and Potent Agonist of Galanin Receptors

Cat #: GPG-250
Alternative Name Galanin-like peptide (3-32)
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 3102 Da
    Purity: ≥98% (HPLC)
    Effective concentration 1-50 nM.
    Sequence AHRGRGGWTLNSAGYLLGPVLHLPQMGDQ.
    Structure
    Molecular formula C137H213N43O38S1.
    Activity Human GALP (3-32) is a Galanin receptor agonist1.
    References-Activity
    1. Lang, R. et al. (2005) Neuropeptides 39, 179.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in water. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs human GALP (3-32) activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Alomone Labs human GALP (3-32) activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Dose response of normalized activation Galanin 2 receptor-mediated Ca2+ mobilization, evoked by human GALP (3-32) (#GPG-250). Ca2+ response was detected by measuring aequorin-derived fluorescence following application of human GALP (3-32) at different concentrations. The EC50 measured for human GALP (3-32) is 11.1 nM.
    References - Scientific background
    1. Lang, R. et al. (2005) Neuropeptides 39, 179.
    2. Schmidhuber, S.M. et al. (2007) J. Invest. Dermatol. 127, 716.
    Scientific background

    Human GALP (3-32) fragment is a human galanin-like peptide that acts as a non-selective and potent galanin receptor agonist. Human GALP consists of 60 amino acid with a potential proteolytic cleavage site between two basic amino acids in position 33.

    Human GALP (3-32) shares amino acids in position 9-21 with the first 13 amino acids of galanin, an essential sequence for activating galanin receptors1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.

    Human GALP (3-32) is at least as potent as full length GALP. Studies suggest that GALP (3-32) fragment can represent the strongest mediator of biological GALP activity. GALP (3-32) can be used as a useful tool for studding the affinity of GALP to galanin receptors and to search for specific GALP receptors1,2. Human GALP (3-32) displays highest affinity to GalR3 with an IC50 value of 10 nM, followed by GalR2 with IC50 of 28 nM and GalR1 with IC50 of 77 nM1.

    Target Galanin receptors
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/01/2022

    human GALP (3-32) (#GPG-250) is a highly pure, synthetic, and biologically active peptide.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us