Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Inward Rectifier K+ Channels › Blockers

Lq2

K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2

A Potent Blocker of Kir1.1 (ROMK1) Channels

Cat #: RTL-550
Alternative Name K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Recombinant, E. coli
    MW: 4353 Da
    Purity: >98% (HPLC)
    Effective concentration 0.1-10 nM.
    Sequence QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS.
    Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35.
    Structure
    Molecular formula C177H280N60O55S7.
    Activity Lq2 inhibits Kir1.1 K+ inward rectifier channels2, as well as KCa channels1.
    References-Activity
    1. Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
    2. Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Lq2 inhibits Kir1.1 (ROMK1) channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Lq2 inhibits Kir1.1 (ROMK1) channels heterologously expressed in Xenopus oocytes.
      A. ROMK1 channel current (in 5 mM K+) elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV, before and during application of Lq2 (#RTL-550) at the indicated concentrations. B. Mean ±S.D. dose response for Lq2 inhibition of ROMK1 channels (n = 4-6 oocytes for each time point). The smooth line is a fit giving a Ki of 5 nM. C. Mean ± S.D. I-V relation of control and inhibited currents (n = 4).
    References - Scientific background
    1. Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
    2. Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
    Scientific background

    Lq2 was originally isolated from Leiurus quinquestriatus hebraeus scorpion venom.1

    Lq2 blocks Kir1.1 K+ inward rectifier channels (Ki of 410 nM).2

    In the planar lipid bilayer, it also blocked single KCa channels from rat muscle with intrinsic KD of 43 nM,1 by introducing brief closures. Lq2 action is on the extracellular side of the pore.

    Target Kir1.1 K+ channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 06/11/2022

    Lq2 (#RTL-550) is a highly pure, recombinant, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Citations

    Citations
    Product citations
    1. Meneses, D. et al. (2015) Synapse. 69, 446.

    Specifications

    Scientific Background

    Related Products

    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us