Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

Lysosomal Ion Channel Antibody Explorer Kit

A Screening Package of Lysosomal Ion Channel Antibodies Economically Priced

Cat #: AK-530
Size: 18 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CLC-3 (CLCN3) Antibody Cat #: ACL-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3 (Accession P51792). Intracellular, near the C-terminus.
Homology
Mouse - identical; human, rabbit, guinea pig - 69/70 amino acid residues identical; Xenopus laevis - 61/70 amino acid residues identical.
Rat CLC-4 - 46/70 amino acid residues identical; rat CLC-5 - 49/70 amino acid residues identical.

CLC-3/CLCN3 Blocking Peptide Cat #: BLP-CL001

Size: 0.12 mg

Anti-CLC-5 Antibody Cat #: ACL-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: M, R
Immunogen
Peptide CDYENHFNTSKGGEL, corresponding to amino acid residues 401-415 of rat CLCN5 (Accession P51796). Extracellular.
Homology
Mouse - identical; human - 14/15 amino acid residues identical.

CLC-5 Blocking Peptide Cat #: BLP-CL003

Size: 40 µg

Anti-CLC-7 (CLCN7) Antibody Cat #: ACL-008

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)KDLARYRLGKGGLE, corresponding to amino acid residues 783-796 of rat CLC-7 (Accession P51799). Intracellular, C-terminal.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.

CLC-7/CLCN7 Blocking Peptide Cat #: BLP-CL008

Size: 40 µg

Anti-SLC17A5 (Sialin) Antibody Cat #: AST-015

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KGEVQSWALSDHHG, corresponding to amino acid residues 479-492 of mouse SLC17A5 (Accession Q8BN82). Intracellular, C-terminus.
Homology
Rat – 13/14 amino acid residues identical; human – 12/14 amino acid residues identical.

SLC17A5/Sialin Blocking Peptide Cat #: BLP-ST015

Size: 40 µg

Anti-TPCN1 Antibody Cat #: ACC-071

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RNLRQIFQSLPPFMD, corresponding to amino acid residues 221-235 of rat TPCN1 (Accession Q9WTN5). 2nd luminal loop.
Homology
Mouse, human - identical.

TPCN1 Blocking Peptide Cat #: BLP-CC071

Size: 40 µg

Anti-TPCN2 Antibody Cat #: ACC-072

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide KKTLKSIRW(S)LPE(C), corresponding to amino acid residues 187-199 of mouse TPCN2 with replacement of amino acid 192 with serine (S) (Accession Q8BWC0). 2nd luminal loop.
Homology
Mouse, rat, human - 12/13 amino acid residues identical.

TPCN2 Blocking Peptide Cat #: BLP-CC072

Size: 40 µg

Anti-TRPML1 (Mucolipin 1) Antibody Cat #: ACC-081

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)GRRASETERLLTPN, corresponding to amino acid residues 6-19 of mouse TRPLM1 (Accession Q99J21). Intracellular, N-terminus (cytoplasmic).
Homology
Human, rat - 12/14 amino acid residues identical.

TRPML1/Mucolipin 1 Blocking Peptide Cat #: BLP-CC081

Size: 40 µg

Anti-TRPML2 (Mucolipin-2) Antibody Cat #: ACC-082

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RLDFYRLVQVDISFALK, corresponding to amino acid residues 212-228 of mouse TRPML2 (Accession Q8K595). Intracellular, N-terminus.
Homology
Rat - 16/17 amino acid residues identical; human - 13/17 amino acid residues identical.

TRPML2/Mucolipin-2 Blocking Peptide Cat #: BLP-CC082

Size: 40 µg

Anti-TRPML3 (Mucolipin 3) Antibody Cat #: ACC-083

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide CKDLPNSGKYRLEDD, corresponding to amino acid residues 528-542 of mouse TRPML3 (Accession Q8R4F0). Intracellular, C-terminus (cytoplasmic).
Homology
Rat, human - identical.

TRPML3/Mucolipin 3 Blocking Peptide Cat #: BLP-CC083

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information