Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

Nodes of Ranvier Antibody Explorer Kit

A Screening Package of Nodes of Ranvier Antibodies Economically Priced

Cat #: AK-600
Size: 15 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-SCN1A (NaV1.1) Antibody Cat #: ASC-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Peptide (C)TASEHSREPSAAGRLSD, corresponding to amino acid residues 465-481 of rat NaV1.1 (Accession P04774). Intracellular loop between domains I and II.
Human - identical.

Guinea pig Anti-SCN2A (NaV1.2) Antibody Cat #: AGP-026

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)ASAESRDFSGAGGIGVFSE, corresponding to amino acid residues 467-485 of rat NaV1.2 (Accession P04775). Intracellular loop between domains I and II.
Human - identical.
NaV1.3 - 12/15 amino acid residues identical.

Anti-NaV1.6 (SCN8A) Antibody Cat #: ASC-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Peptide CIANHTGVDIHRNGDFQKNG, corresponding to amino acid residues 1042-1061 of rat NaV1.6 (Accession O88420). Intracellular loop between domains II and III.
Mouse - identical; human - 19/20 amino acid residues identical.

Anti-SCN1B (NaVβ1) (extracellular) Antibody Cat #: ASC-041

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Peptide CKRRSETTAETFTE, corresponding to amino acid residues 43-56 of rat β1 subunit of voltage-gated Na+ channels (Accession Q00954). Extracellular, N-terminus.
Mouse - identical; human -13/14 amino acid residues identical.

Anti-SCN2B (NaVβ2) Antibody Cat #: ASC-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)KTEEEGKTDGEGNAEDGAK, corresponding to amino acid residues 197-215 of rat β2 subunit of voltage-gated Na+ channels (Accession P54900). Intracellular, C-terminus.
Human - 17/19 amino acid residues identical.

Anti-SCN4B (NaVβ4) (extracellular) Antibody Cat #: ASC-044

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: H, M, R
Peptide (C)KNDKSDPKVRVKDD, corresponding to amino acid residues 85-98 of rat β4 subunit of voltage-gated Na+ channels (Accession Q7M730). Extracellular, N-terminus.
Mouse - identical; human - 11/14 amino acid residues identical.

Anti-KV1.1 (KCNA1) Antibody Cat #: APC-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388). Intracellular, C-terminus.
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical.

Anti-KV3.1b (KCNC1) Antibody Cat #: APC-014

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat KV3.1b (Accession P25122). Intracellular, C-terminus.
Mouse, human, dog – identical.

Anti-KCNQ2 Antibody Cat #: APC-050

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Peptide (C)RGPTITDKDRTKGPAE, corresponding to amino acid residues 578-593 of rat KCNQ2 (Accession O88943). Intracellular, C-terminus.
Mouse - identical; human - 15/16 amino acid residues identical.

Anti-KCNQ3 Antibody Cat #: APC-051

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat KCNQ3 (Accession O88944). Intracellular, C-terminal.
Mouse - identical; human - 18/19 amino acid residues identical.

Anti-ADAM22 (extracellular) Antibody Cat #: ANR-120

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)HNDDAKTGITLSGNG, corresponding to amino acid residues 715-729 of mouse ADAM22 (Accession Q9R1V6). Extracellular, N-terminus.
Rat, human - identical.

Anti-Caspr2 Antibody Cat #: APZ-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)DPNFTETIDESKKEWLI, corresponding to amino acid residues 1315-1331 of human Caspr2 (Accession Q9UHC6). Intracellular, C-terminus.
Mouse, rat - identical.

Anti-Neurofascin Antibody Cat #: AIP-025

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Peptide (C)REKKDVPLGPEDPK, corresponding to amino acid residues 1142-1155 of rat NFASC (Accession P97685). Intracellular, C-terminus.
Mouse, human – identical.

Anti-PSD-93 Antibody Cat #: APZ-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110 (Accession Q63622). Between PDZ2 and PDZ3 domains.
Human - 42/44 amino acid residues identical.

Anti-PSD-95 Antibody Cat #: APZ-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)KDWGSSSGSQGRED, corresponding to amino acid residues 505-518 of human PSD-95 (Accession P78352). Intracellular, between the SH3 and the GK-like domains.
Rat, mouse – identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

A guinea pig polyclonal antibody (#AGP-026) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use
Shipping and Ordering information