Free shipping starts now, no minimum, no coupons required!

Stromatoxin-1

κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1

A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels

Cat #: STS-350
Alternative Name κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3792 Da
    Purity: >98% (HPLC)
    Effective concentration 1.2-670 nM.
    Sequence DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI.
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys28, Ile34 - C-terminal amidation.
    Structure
    Molecular formula C156H237N49O48S7.
    Activity Stromatoxin-1 is a potent inhibitor of voltage-gated K+ channels. It inhibits delayed KV2.1, KV2.1/9.3, KV2.2, and transient KV4.2 channels1,2.
    References-Activity
    1. Escoubas, P. et al. (2002) Mol. pharmacol62, 48.
    2. Shiau, Y.S. et al. (2003) Chem. Res. Toxiol. 16, 1217.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all products preparations before use (1000 X g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Stromatoxin-1 inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Stromatoxin-1 inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
      Left: Time course of KV2.1 current amplitude before and during application of 100 nM Stromatoxin-1 (#STS-350). The periods of Stromatoxin-1 perfusion is indicated by the horizontal bar.
      Right: Stromatoxin-1 dose-dependent inhibition of KV2.1 current amplitude.
    References - Scientific background
    1. Escoubas, P. et al. (2002) Mol. pharmacol62, 48.
    2. Shiau, Y.S. et al. (2003) Chem. Res. Toxiol16, 1217.
    Scientific background

    Stromatoxin-1 is a 34 amino acid peptidyl toxin originally isolated from Stromatopelma calceatum tarantula1. Structurally, Stromatoxin-1 belongs to the scaffold of structural inhibitor cysteine knot peptide family, which were shown to function as gating modifiers2.

    Stromatoxin-1 selectively inhibits KV2.1, KV2.1/9.3, and KV4.2 channel currents (IC50 of 12.7 nM, 7.2 nM and 1.2 nM respectively), and is the first high-affinity voltage gating modifier inhibitor of the KV2.2 channel subtype (IC50, 21.4 nM) to be discovered1.

    Target Various KV channels
    Net Peptide Content: 100%
    Last update: 11/04/2021

    Stromatoxin-1 (#STS-350) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Nishijima, Y. et al. (2017) Circ. Res. 120, 658.
    2. Regnier, G. et al. (2016) Physiol. Rep. 4, e12731.
    3. Nieves-Cintrón, M. et al. (2015) J. Biol. Chem. 290, 7918.
    4. Tsantoulas, C. et al. (2014) Exp. Neurol. 251, 115.
    5. Fox, P.D. et al. (2013) J. Neurosci. 33, 1259.
    6. Bocksteins, E. et al. (2012) Am. J. Physiol. 303, C406.
    7. Tsantoulas, C. et al. (2012) J. Neurosci. 32, 17502.
    8. Guan, D. et al. (2011) J. Neurophysiol. 106, 1722.
    Shipping and Ordering information