Cat #:
STT-400
Alternative Name K+ channel toxin α-KTx 5.4
Lyophilized Powder yes
Bioassay Tested
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Synthetic peptide
MW: 3458.16 Da.
Purity: >98% (HPLC)
Effective concentration 500 pM - 50 nM.
Sequence AFCNLRRCELSCRSLGLLGKCIGEECKCVPY.
Modifications Disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28. Tyr31 - C terminal amidation.
Molecular formula C146H238N44O41S6
Activity Tamapin blocks KCa2 channels. Tamapin displays a remarkable selectivity for KCa2.2 versus KCa2.1 channels1.
References-Activity
- Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Tamapin completely inhibits KCa2.2 (SK2) currents heterologously expressed in Xenopus oocytes.Current traces recorded at +5 mV. At the indicated time (arrow) 25 nl of 100 mM CaCl2 was injected into the oocyte in order to activate outward current. 100 nM Tamapin (#STT-400) were perfused for 1 min (green) to completely inhibit the current.
References - Scientific background
- Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865.
- Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.
Scientific background Tamapin is a 31 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is classified as α-5.4 scorpion toxin family1 with three disulfide bridges. Native Tamapin blocks KCa2 channels in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct KCa2 channel subunits. Tamapin displays a remarkable selectivity for KCa2.2 (SK2/KCNN2, IC50 = 24 pM) versus KCa2.1 (SK1/KCNN1, approx 1750 fold) and KCa2.3 (SK3/KCNN3) channels2.
Target KCa2 K+ channels
Net Peptide Content: 100%
Lyophilized Powder
Last update: 02/03/2021
Tamapin (#STT-400) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Specifications
Scientific Background
Citations
Citations
Product citations
- Chubanov, V. et al. (2012) Br. J. Pharmacol. 166, 1357.
Related Products
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us