Free shipping starts now, no minimum, no coupons required!
Home › Products › Neural Signaling › Neurotransmission › Purinergic Signaling › Purinergic (P2X) Receptors › Agonists

BomoTx Toxin

BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin

A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist

Cat #: NTB-200
Alternative Name BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
Lyophilized Powder yes
Origin Natural peptide isolated from Bothrops moojeni (Brazilian lancehead pit viper).
MW: 13834 Da
Purity: >99% (HPLC)
Form Lyophilized powder.
Effective concentration 1 µM.
Sequence SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCKKADPC.
Modifications The exact location of the disulfide bridges is currently unknown.
Structure

  • The exact location of the disulfide bridges is currently unknown.
Molecular formula C598H942N166O181S15
Activity BomoTx Toxin excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
References-Activity
  1. Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524.
Accession number A0A1S5XW05.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
References - Scientific background
  1. Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524.
  2. Pasqualetto, G. et al. (2018) Front. Pharmacol. 9, 58.
Scientific background

BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.

BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.

P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1–P2X72.

Target P2X2/P2X3 receptors
Peptide Content: 100%
Lyophilized Powder
Image & Title

BomoTx Toxin
BomoTx-induced currents are mediated by ATP.A. Representative current–voltage relationship of BomoTx-evoked conductance from transiently activated TG neurons demonstrates inwardly rectified currents that reverse at 0 mV. B. Representative whole-cell voltage-clamp experiments on TG neurons showing that Ro51 (a P2X3 receptor antagonist) blocks BomoTx-evoked current. C. BomoTx does not directly activate HEK cells expressing rat P2X2, P2X3, or P2X2/3 channels.Adapted from Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524. with permission of the National Academy of Sciences.

Last update: 06/11/2022

BomoTx Toxin (#NTB-200) is a highly pure, natural, and biologically active peptide toxin.

See Related Products

For research purposes only, not for human use
Shipping and Ordering information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

Call us at
+972 2587 2202 or Email Us