Overview
Cat #:
STC-100
Alternative Name β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4093 Da
Purity: >98% (HPLC)
Effective concentration 5 nM - 2 µM.
Sequence DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL.
Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys22, Cys16-Cys29. Leu33 - C-terminal amidation.
Structure
Molecular formula C177H260N52O49S6.
Activity Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.
References-Activity
- Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Ceratotoxin-2 inhibits NaV1.2 channels heterologously expressed in Xenopus oocytes.NaV1.2 currents were elicited by application of voltage step of 100 ms from -80 mV (holding potential) to 10 mV. A. Time course of channel activity (peak current amplitude) before (black) and during (green) application of 200 nM Ceratotoxin-2 (#STC-100). B. Example of superimposed current traces before (black) and during (green) application of the toxin, taken from the experiment in A.
References - Scientific background
- Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.
Scientific background
Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.
Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.
Target NaV channels
Peptide Content: 100%
Lyophilized Powder
Ceratotoxin-2 (#STC-100) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Last Update: 02/01/2024
Applications
Citations
Citations