Free shipping starts now, no minimum, no coupons required!

Recombinant human Cardiotrophin-1 protein

CT-1

human Cardiotrophin-1, Recombinant, E. coli

Cat #: C-200
Alternative Name CT-1
Lyophilized Powder yes
  • Bioassay Tested
  • Sterile & Endotoxin Free yes
    Origin Recombinant, E. coli
    MW: 21.1 kDa
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Sequence SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
    Activity Cardiotrophin-1 is a member of the neuropoietic cytokine family which enhances the survival of ciliary and dopaminergic neurons through the interaction with the gp130 receptor. Cardiotrophin-1 induces cardiac myocyte hypertrophy and has been shown to promote the survival of both embryonic and neonatal rat ventricular muscle cells1-3.
    References-Activity
    1. Pennica, D. et al. (1995) Proc. Natl. Acad. Sci U.S.A. 92, 1142.
    2. Cheng, J.G. et al. (1997) J. Neurochem69, 2278.
    3. Sheng, Z. et al. (1996) Development 122, 419.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    • Alomone Labs Recombinant human Cardiotrophin-1 protein induces ERK1/2 MAPK phosphorylation.
      Alomone Labs Recombinant human Cardiotrophin-1 protein induces ERK1/2 MAPK phosphorylation.
      3T3-L1 cells were grown to 70% confluence, serum starved for 3 h and then stimulated with various concentrations of Recombinant human Cardiotrophin-1 protein (#C-200) for 10 min. The cell proteins were resolved by SDS PAGE and probed with anti-Phospho-ERK 1/2 MAPK.
    References - Scientific background
    1. Pennica, D. et al. (1995) Proc. Natl. Acad. Sci. U.S.A. 92, 1142.
    2. Pennica, D. et al. (1996) Neuron 17, 63.
    3. Sheng, Z. et al. (1996) Development 122, 419.
    4. Fukuzawa, J. et al. (2000) Hypertension 35, 1191.
    5. Weiss, T.W. (2003) Cardiovasc. Res. 59, 628.
    6. Talwar, S. et al. (2000) Clin. Sci. (Lond). 99, 83.
    7. Oppenheim, R.W. et al. (2001) J. Neurosci. 21, 1283.
    8. Cheng, J.G. et al. (1997) J. Neurochem. 69, 2278.
    9. Pennica, D. et al. (1995) J. Biol. Chem. 270, 10915.
    10. Lesbordes, J.C. et al. (2003) Hum. Mol. Genet. 12, 1233.
    11. Zhang, Z.F. et al. (2003) Neurotox. Res. 5, 539.
    12. Bordet, T. et al. (2001) Hum. Mol. Genet. 10, 1925.
    13. Talwar, S. et al. (2002) Clin. Sci. (Lond). 102, 9.
    Scientific background

    Cardiotrophin-1 is a member of the neuropoietic cytokine family (LIF, CNTF, OSM IL-11, IL-6). Cardiotrophin-1 is a strong inducer of cardiac hypertrophy, exerts cardio-protective effects and plays a role in neuronal growth and differentiation.1,2

    In neonatal rat, Cardiotrophin-1 has been shown to promote cardiac myocyte survival and to enhance embryonic myocyte proliferation during cardiac chamber development.3 Cardiotrophin-1 increases angiotensinogen gene transcription and induces VEGF expression in cardiac myocytes.4,5 It also induces vessel growth during cardiac remodelling, an effect that may contribute to its cardio-protective properties.

    In humans, a recent report showed an increase in circulating Cardiotrophin-1 in heart failure.6 A strong correlation between the increased Cardiotrophin-1 and the severity of left ventricular systolic dysfunction was found.7

    Cardiotrophin-1 is a very potent neurotrophic factor for motoneurons in long-term culture and protects neonatal rat motoneurons from axotomy-induced cell death.2,8 It was able to modulate the synthesis of specific neurotransmitters by cultured neuronal cells,9 and to promote the survival of rat dopaminergic and chick ciliary neurons.10 Recently, the potential for neuroprotection by Cardiotrophin-1 was investigated in animal models characterized by a prominent axonal degeneration.11-13

    Peptide Content: 100%
    Last update: 12/08/2021

    Recombinant human Cardiotrophin-1 protein (#C-200) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use

    Applications

    Citations

    Citations
    Product citations
    1. Zhai, J. et al. (2015) J. Neurosci. 35, 9088.

    Specifications

    Scientific Background

    Shipping and Ordering information