Free shipping starts now, no minimum, no coupons required!

Recombinant human CNTF protein

Ciliary Neurotrophic Factor

Human Ciliary Neurotrophic Factor, Recombinant, E. coli

Cat #: C-240
Alternative Name Ciliary Neurotrophic Factor
Lyophilized Powder yes
  • Bioassay Tested
  • Sterile & Endotoxin Free yes
    Origin Recombinant, E. coli
    MW: 22.9 kDa
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration EC50 = 1 nM.
    Sequence MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
    Activity CNTF is a potent neurotrophic factor that was originally characterized as a survival factor for chick ciliary neurons. CNTF supports growth and survival of DRG, motor and sympathetic neurons1-4.
    References-Activity
    1. Sendtner, M. et al. (1990) Nature 345, 440.
    2. Barbin, G. et al. (1984) J. Neurochem. 43, 1468.
    3. Manthorpe, M. et al. (1986) Brain Res. 367, 282.
    4. Kotzbauer, P.T. et al. (1994) Neuron 12, 763.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 μg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    • Alomone Labs Recombinant human CNTF protein promotes the phosphorylation of STAT3 in preadipocyte 3T3-L1 cells.
      Alomone Labs Recombinant human CNTF protein promotes the phosphorylation of STAT3 in preadipocyte 3T3-L1 cells.
      Cells were stimulated with increasing concentrations of Recombinant human CNTF protein (#C-240) for 10 min. The cells were subjected to western blot analysis and the activation of Stat3 was determined using anti-phospho-Stat3 antibody.
    References - Scientific background
    1. Mufson, E.J. et al. (1999) Prog. Neurobiol. 57, 451.
    2. Adler, R. et al. (1979) Science 204, 1434.
    3. Murphy, M. et al. (1997) Prog. Neurobiol. 52, 355.
    4. Henderson, J.T. et al. (1994) Mol. Brain Res. 22, 151.
    5. Stahl, N. et al. (1993) J. Biol. Chem. 268, 7628.
    6. Richardson, P.M. (1994) Pharmacol. Ther. 63, 187.
    7. Ip, N.Y. et al. (1991) J. Physiol. 85, 123.
    8. Gurney, M.E. et al. (1992) J. Neurosci. 12, 3241.
    9. Sendtner, M. et al. (1992) Nature 358, 502.
    10. Mayer, M. et al. (1994) Development 120, 143.
    Scientific background

    CNTF is a polypeptide trophic factor, a member of the alpha-helical cytokine superfamily1. It was initially purified from the chick eye on the basis of its ability to promote survival of E8 chick ciliary ganglion neurons in culture2. CNTF is synthesized by glia both in the CNS and PNS3 and it has been shown to be ubiquitously distributed in neurons and glia throughout the rodent brain4. CNTF effects are mediated by a tripartite receptor complex consisting of two signal-transducing subunits (leukemia inhibitory factor receptor, gp130) and a CNTF-specific ligand-binding-subunit (CNTFR)5.

    CNTF can support the survival of many different cell populations within the PNS and CNS6. In vitro, CNTF promotes proliferation and neuronal specifications in hippocampal neurons. In vivo, it supports the viability of non-primate motor neurons7, induces sprouting of cholinergic motor neurons8 and delays neural degeneration in genetic models of motor neuron disease9. In addition, it is involved in the development stage of astrocytes and oligodendocytes10.

    Peptide Content: 100%
    Last update: 12/08/2021

    Recombinant human CNTF protein (#C-240) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use

    Applications

    Citations

    Citations
    Product citations
    1. Zhai, J. et al. (2015) J. Neurosci. 35, 9088.
    2. Kelly, C.E. et al. (2013) PLoS ONE 11, e1001538.
    3. Albrecht, D. et al. (2012) Mol. Cell. Neurosci. 49, 364.
    4. Jeong, G.B. et al. (2011) J. Neurosci. 31, 295.

    Specifications

    Scientific Background

    Shipping and Ordering information