Free shipping starts now, no minimum, no coupons required!

Recombinant human LIF protein

Leukemia Inhibitory Factor

Human Leukemia Inhibitory Factor, Recombinant, E. coli

Cat #: L-200
Alternative Name Leukemia Inhibitory Factor
Lyophilized Powder yes
  • Bioassay Tested
  • Sterile & Endotoxin Free yes
    Origin Recombinant, E. coli
    MW: 19.7 kDa
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration EC50 = ~10 pM.
    Sequence MSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF.
    Activity LIF is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF regulates cholinergic, peptidergic and noradrenergic properties of sympathetic neurons and rescues sensory and motor neurons from death. LIF also promotes differentiation of O-2A astrocytes1-4.
    References-Activity
    1. Bamber, B.A. et al. (1994) Proc. Natl. Acad. Sci. U.S.A91, 7839.
    2. Ludlam, W.H. et al. (1994) Dev. Biol164, 528.
    3. Curtis, R. et al. (1994) Neuron 12, 191.
    4. Mayer, M. et al. (1994) Development 120, 143.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml.
    BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    • Alomone Labs Recombinant human LIF protein activates ERK1/2 MAPK and STAT3 in 3T3-L1 cells.
      Alomone Labs Recombinant human LIF protein activates ERK1/2 MAPK and STAT3 in 3T3-L1 cells.
      Cells were serum starved for 2 h and stimulated with 100 ng/ml of Recombinant human LIF protein (#L-200) for 10 min. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-STAT3 and anti-phospho-ERK1/2.
    References - Scientific background
    1. Brach, M.A. et al. (1990) Leukemia 4, 646.
    2. Estrov, Z. et al. (1992) Leuk. Lymphoma 8, 1.
    3. Gough, N.M. et al. (1989) Cancer Cells. 1, 77.
    4. Metcalf, D. (2003) Stem Cells 21, 5.
    5. Zurn, A.D. and Werren, F. (1994) Dev. Biol. 163, 309.
    6. Martinou, J.C. et al. (1992) Neuron 8, 737.
    7. Gadient, R.A. and Patterson, P.H. (1999) Stem Cells 17, 127.
    8. Patterson, P.H. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 7833.
    9. Gabay, C. et al. (1996) Clin. Exp. Immunol. 105, 260.
    10. Lass, A. et al. (2001) Fertil. Steril. 76, 1091.
    11. Robb, L. et al. (2002) J. Reprod. Immunol. 57, 129.
    12. Ledee Bataille, N. et al. (2002) Hum. Reprod. 17, 213.
    13. Vos, J.P. et al. (1996) Perspect. Dev. Neurobiol. 4, 39.
    14. Butzkueven, H. et al. (2002) Nat. Med. 8, 613.
    15. Horton, A.R. et al. (1996) Perspect. Dev. Neurobiol. 4, 35.
    16. Murphy, M. et al. (1997) Prog. Neurobiol. 52, 355.
    17. Rajan, P. et al. (1995) Neuroreport 6, 2240.
    18. Akita, S. et al. (1996) J. Clin. Endocrinol. Metab. 81, 4170.
    Scientific background

    Leukemia inhibitory factor (LIF) was identified by its ability to induce terminal differentiation in leukemic cells.1,2 LIF is a pleiotrophic factor with known actions in the immune system, the nervous system and the reproductive system.3,4

    In the nervous system it acts on cultured sympathetic neurons to direct a change in neurotransmitter expression from a noradrenergic to a cholinergic phenotype and regulates the expression of neuropeptide transmitters in these cells.5,6

    In the immune system LIF plays a key role in inflammation,7,8 with a pro-inflammatory role in rheumatoid arthritis,9 but also with proposed anti-inflammatory properties in lung inflammatory processes.

    In the reproductive system, LIF appears to play an important role in implantation and in the establishment of pregnancy.10,12 LIF acts as a trophic factor for oligodendrocytes and promotes astrocytic survival and differentiation.13,14 It exhibits activity towards spinal motor neurons and stimulate the biosynthesis of acetylcholine.6

    LIF also functions as a trophic factor for peripheral sensory neurons supporting their survival.15,16 LIF appears to be essential for injury-induced neuropeptide synthesis17 and can also stimulate the hypothalamic-pituitary-adrenal axis in response to stress and disease.18 LIF is used extensively in experimental biology because of its ability to induce embryonic stem cells to retain their totipotentiality.

    Net Peptide Content: 100%
    Last update: 11/04/2021

    Recombinant human LIF protein (#L-200) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Steelman, A.J. et al. (2016) Neurobiol. Dis. 91, 336.
    2. Tingling, J.D. et al. (2013) PLoS ONE 8, e69560.
    3. Koechling, T. et al. (2011) J. Neurosci. Meth. 201, 346.
    4. Uchida, H. et al. (2011) J. Neurooncol. 104, 697.
    Shipping and Ordering information