Recombinant human EGF protein

Epidermal Growth Factor, Urogastrone, Beta Urogastrone, URG
Human Epidermal Growth Factor, Recombinant, E. coli
    Cat #: E-100
    Alternative Name Epidermal Growth Factor, Urogastrone, Beta Urogastrone, URG
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Origin Recombinant, E. coli
    MW: 6.2 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration EC50 = 20 pg/ml.
    Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
      • Recombinant human EGF protein
    Activity EGF is a potent growth factor that stimulates both in vitro and in vivo the proliferation of various epidermal and epithelial cells1. Fibroblasts are also stimulated in vitro by EGF2,3.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 μg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • Recombinant human EGF protein
        Alomone Labs Recombinant human EGF protein promotes the phosphorylation of ERK1/2 in preadipocyte 3T3-L1 cells.
        Cells were stimulated with increasing concentrations of Recombinant human EGF protein (#E-100) for 6 min. The cells were subjected to western blot analysis and the activation of ERK1/2 was determined using anti-phospho-ERK1/2 antibody.
    References - Scientific background
      • The epidermal growth factor (EGF) family is important in regulating growth, maturation, function, and maintenance in epithelial tissues (particularly the mammary glands and gastrointestinal tract) and the nerve system. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro1 and of some fibroblasts in cell culture2-3.

        The EGF family is comprised of 13 members, which are all membrane-anchored proteins, in addition to their properties as ligands that activate epidermal growth factor receptor (EGFR), bearing tyrosine kinase activity4.

        The EC50 of EGF is 0.05-5.0 ng/ml using Balb/MK cells5, and its importance as a potential therapeutic agent has been extended by the realization that EGF-like activities may be involved in wound healing and could alter cell growth in cancer3,6. The risk of cancer is increased by EGF and therefore, inhibiting it decreases cancer risk. There are two classes of inhibitors: the small-molecule EGFR tyrosine kinase inhibitors (SMTKIs) and monoclonal antibodies to the receptors7.

        EGF is also a magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Defects in EGF are the cause of hypomagnesemia type 4 (HOMG4), also known as renal hypomagnesemia normocalciuric. HOMG4 is a disorder characterized by massive renal hypomagnesemia and normal levels of serum calcium and calcium excretion. Clinical features include seizures, mild-to moderate psychomotor retardation, and brisk tendon reflexes8.

    Net Peptide Content: 100%
    Last update: 02/09/2019

    Recombinant human EGF protein (#E-100) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use