Free shipping starts now, no minimum, no coupons required!
Home › Products › Neurotrophic Factors and Receptors › Growth Factors and Receptors › Insulin Growth Factors and Receptors › Proteins

Recombinant rat IGF-I protein

Insulin-like growth factor I, Somatomedin C, IGF-1, IGFIA, IGF1, IBP1

Rat Insulin-like growth factor I, Recombinant, E. coli

Cat #: I-200
Alternative Name Insulin-like growth factor I, Somatomedin C, IGF-1, IGFIA, IGF1, IBP1
Lyophilized Powder yes
  • Bioassay Tested
    • Sterile & Endotoxin Free yes
    Origin Recombinant, E. coli
    MW: 7692 Da
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration The ED50 as determined by a cell proliferation assay using FDC-P1 cells is less than 2.0 ng/ml, corresponding to a specific activity of >500,000 units/mg.
    rat IGF-I is fully biologically active when compared to standards. The ED50 shown in literature was calculated in two different methods: 1. Stimulation of protein synthesis in rat L6 myoblasts ED50 was found to be less than 30 ng/ml. 2. Type 1 IGF receptor binding assay ED50 was found to be less than 10 ng/ml.
    Sequence GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA.
    Modifications Disulfide bonds between Cys6-Cys48, Cys18-Cys61, Cys47-Cys52.
    Structure
    Molecular formula C336H522N94O99S7.
    Activity IGF-I is a pleiotropic factor involved in multiple processes, so its actions are different depending on its concentration, the cell type, and the developmental stage of the animal1. IGF-I promotes proliferation of neural cells by interacting with the IGF-IR which may activate the PI3K/Akt or the MAP kinase pathways1.
    Evidence indicates that IGF-I promotes cell survival by inhibiting apoptosis both in vivo and in vitro. IGF-I is also involved in the regulation of the migration of certain cell types1.
    Accession number P08025.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    • Alomone Labs Recombinant rat IGF-I protein promotes survival of PC12 cells.
      Alomone Labs Recombinant rat IGF-I protein promotes survival of PC12 cells.
      Dose-response curve of Recombinant rat IGF-I protein (#I-200) facilitation of survival of serum-deprived PC12 cells. Cell viability was determined by the XTT method and normalized to serum-supplemented control. EC50 was calculated at 12.5 ng/ml.
    References - Scientific background
    1. Nieto-Estevez V. et al. (2016) Front. Neurosci. 10, 52.
    2. Orru, S. et al. (2017) Int. J. Mol. Sci. 18, 2145.
    Scientific background

    Insulin-like growth factor-I (IGF-I) belongs to the insulin family which is divided in two groups of peptides: 1- insulin and IGFs and 2- relaxin and insulin-like hormones. The structure of mature IGF-I is composed of a single polypeptide chain of 70 amino acids with 57 amino acids being identical across different organisms1,2.

    IGF-I is a pleiotropic factor responsible for the regulation of several cellular processes depending on its concentration, cell type and the developmental stage of the organism.

    IGF-I binds to IGF-I receptor and triggers the auto phosphorylation of the receptor and the activation of the insulin receptor substrates1.

    In the embryonic brain IGF-I expression is relatively high and drops sharply in the adult brain except in the hippocampus and the subventricular zone-olfactory bulb. In adults IGF-I is mainly synthesized in the liver though a process regulated by the growth hormone (GH). IGF-I can cross the blood-brain-barrier by binding to the IGF-I receptor present on endothelial cells and is later picked up by astrocytes to be transferred to neurons or directly by neurons1,2.

    Studies show that IGF-I influences neural stem cell proliferation and differentiation into neurons and glia as well as neuronal maturation including synapse formation. IGF-I also promotes adult neurogenesis by regulating neural stem cell number and differentiation1.

    Target IGF receptor
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 12/08/2021

    Recombinant rat IGF-I protein (#I-200) is a highly pure and biologically active recombinant protein expressed in and extracted from E. coli.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us