Recombinant human Persephin protein

PSP
Human Persephin, Recombinant, E. coli
    Cat #: P-320
    Alternative Name PSP
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Origin Recombinant, E. coli
    MW: 20.6 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Sequence MWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG.
    Activity Persephin promotes the survival of mesencephalic, dopaminergic and motor neurons1,2. The receptor for Persephin is a multicomponent complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFR α1-α43,4.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml.
    BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • The activity was determined by the induction of RET phosphorylation using a concentration range of 0.1-1 ng/ml. Recombinant human Persephin protein binds to mammalian GFRα4 with KD of 100 pM.
    References - Scientific background
    • 1. Milbrandt, J. et al. (1998) Neuron 20, 245.
    • 2. Jaszai, J. et al. (1998) J. Neurosci. Res. 53, 494.
    • 3. Bilak, M.M. (1999) Mol. Cell Neurosci13, 326.
    • 4. Enokido, Y. et al. (1998) Curr. Biol. 8, 1019.
    • 5. Masure, S. et al. (2000) J. Biol. Chem275, 39427.
    • 6. Akerud, P. et al. (2002) Mol. Cell. Neurosci. 21, 205.
      • Persephin is a novel neurotrophic factor related to GDNF and Neurturin in the GDNF subfamily.1 Persephin is ubiquitously expressed, although at very low levels.2

        In sharp contrast to GDNF and Neurturin, Persephin does not support the survival of neurons from peripheral ganglia including sympathetic and parasympathetic neurons, sensory neurons and enteric neurons.1,3 Persephin does promote the survival of midbrain dopaminergic neurons after neurotoxic injury and the survival of spinal motor neurons in vitro and in vivo animal models.

        The receptor for Persephin is a multi-component complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFRalpha1-alpha4.4,5

        Persephin induces, in vitro, branching of the ureteric bud of the kidney, an activity shared by Neurturin and GDNF.1 Both in vitro and in vivo experiments using animal models suggest that Persephin could be useful in the treatment of neurodegenerative diseases including Parkinson's disease and Amyotrophic Lateral Sclerosis (ALS).6

    Net Peptide Content: 100%
    Last update: 01/07/2019

    Recombinant human Persephin protein (#P-320) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use