Overview
Type: GST fusion protein
Form: Lyophilized powder
KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001) is the original antigen used for immunization during Anti-KCNJ1 (Kir1.1) Antibody (#APC-001) generation. The blocking peptide binds and ‘blocks’ Anti-KCNJ1/Kir1.1 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat kidney membranes:1. Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (1:200).
2. Anti-KCNJ1 (Kir1.1) Antibody, preincubated with KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001).
Expression of KCNJ1 in rat kidneyImmunohistochemical staining of rat kidney sections using Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (left). There is strong staining (red) of tubular epithelial cells in distal tubes. Note that no staining is observed in proximal tubules (arrow). Counterstain of cell nuclei appears blue. A negative control is shown (right).
Properties
Sequence
- GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560).
Accession (Uniprot) Number P35560
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 0.4 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
