Anti-KCNJ1 (Kir1.1) Antibody

ROMK1, ATP-sensitive inward rectifier potassium channel 1
Cat #: APC-001
Alternative Name ROMK1, ATP-sensitive inward rectifier potassium channel 1
  • KO Validated
  • Lyophilized Powder
  • Antigen Incl.
  • Type: Polyclonal
    Source: Rabbit
    Reactivity: h, m, r
      • GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560), (MW: 33 kDa). Intracellular, C-terminus.
    Accession (Uniprot) Number P35560
    Gene ID P35560
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Mouse - identical; human - 45/50 amino acid residues identical.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.025% NaN3.
    Isotype Rabbit IgG.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.8 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Control antigen reconstitution 100 µl double distilled water (DDW).
    Control antigen storage after reconstitution -20°C.
    Preadsorption Control 3 μg fusion protein per 1 μg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ic, ih, ip, wb
    May also work in: ifc
      • Western blot analysis of rat kidney membranes:
        1. Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (1:200).
        2. Anti-KCNJ1 (Kir1.1) Antibody, preincubated with the control antigen.
        Human submandibular gland (HSG) cells (1:200) (Liu, X. et al. (1999) J. Biol. Chem. 274, 25121.).
      • Rat kidney lysate (4 µg Ab/mg protein) (Chen, P. et al. (2006) Am. J. Physiol. 290, C1355.).
      • Expression of KCNJ1 in rat kidney
        Immunohistochemical staining of rat kidney sections using Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (left). There is strong staining (red) of tubular epithelial cells in distal tubes. Note that no staining is observed in proximal tubules (arrow). Counterstain of cell nuclei appears blue. A negative control is shown (right).
      • Rat mTAL cells (1:200) (Eng, B. et al. (2007) Am. J. Physiol. 293, F1413.).
      • Kir1.1 (KCNJ1, ROMK1) was the first member of the family of inward rectifying Kchannels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.

        The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channel is composed of four subunits that can assemble as either homo or heterotetramers.

        Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.3

        As its original name indicates (ROMK1, Renal Outer Medullary K+ channel), Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain, mainly in the cortex and hippocampus.3

        Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss-of-function mutations in the Kir1.1 gene cause Bartter’s syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.

        Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#STT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.4

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Last update: 10/06/2019

    Anti-KCNJ1 (Kir1.1) Antibody (#APC-001) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

    For research purposes only, not for human use
    Citations
      • Western blot analysis of mouse kidney lysate. Tested in Kir1.1-/- mice.
        Liu, B.C. et al. (2015) J. Am. Nephrol. 26, 1576.
      • Mouse kidney lysate.
        Yoshioka, W. et al. (2016) Am. J. Physiol. 311, F752.
      • Mouse kidney lysate.
        Liu, B.C. et al. (2015) J. Am. Soc. Nephrol. 26, 1576.
      • Mouse kidney lysate (1:800).
        Todkar, A. et al. (2015) J. Am. Soc. Nephrol. 26, 425.
      • Rat cortex and medulla lysates (1:2000).
        Rengarajan, S. et al. (2014) Am. J. Physiol. 306, F1059.
      • Mouse kidney cortex.
        Vitzthum, H. et al. (2014) J. Physiol. 592, 1139.
      • Human submandibular gland (HSG) cells (1:200).
        Liu, X. et al. (1999) J. Biol. Chem. 274, 25121.
      • Rat kidney lysate (4 µg Ab/mg protein).
        Chen, P. et al. (2006) Am. J. Physiol. 290, C1355.
      • Mouse kidney sections (1:4000).
        Todkar, A. et al. (2015) J. Am. Soc. Nephrol. 26, 425.
      • Mouse mpkCCDc14 cells.
        Liu, B.C. et al. (2015) J. Am. Soc. Nephrol. 26, 1576.
      • Rat mTAL cells (1:200).
        Eng, B. et al. (2007) Am. J. Physiol. 293, F1413.
      • Hsieh, S.C. et al. (2008) Rheumatology 47, 150.
      • Huang, C. et al. (2007) Am. J. Physiol. 292, F1073.
      • Rieg, T. et al. (2007) Kidney Int. 72, 566.
      • Yang, S.S. et al. (2007) Cell Metabol. 5, 331.
      • Zhang, X. et al. (2007) Proc. Natl. Acad. Sci. U.S.A. 104, 9517.
      • Bundis, F. et al. (2006) Cell. Physiol. Biochem. 17, 1.
      • Stubbe, J. et al. (2006) Am. J. Physiol. 291, F812.
      • Zhou, Y. et al. (2006) J. Pharmacol. Exp. Ther. 317, 11.
      • Babilonia, E. et al. (2005) J. Biol. Chem. 280, 10790.
      • Lin, D.H. et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 4306.
      • O’Connell, A.D. et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 9954.
      • Lin, D.H. et al. (2004) Am. J. Physiol. 286, F881.
      • Sterling, H. et al. (2002) J. Biol. Chem. 277, 4317.
      • Michelakis, E.D. et al. (2001) Am. J. Physiol. 280, 1138.
      • Wei, Y. el al. (2001) Am. J. Physiol. 281, F206.
      • Mennitt, P.A. et al. (2000) Am. J. Physiol. 278, F916.
    Related Products