Certificate of Analysis

KV1.2 (KCNA2) Channel Premium Research Pack

All You Need for KV1.2 (KCNA2) Channel Research
Cat #: ESP-500 9 Vials

Antibodies

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Homology
Mouse, dog, human, - identical.

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Homology
Mouse - identical; human - 12/13 amino acid residues identical.

KV1.2 (KCNA2) Channel Overexpressed Membrane Fractions Cat #: LX-101

Size: 0.2 ml
Origin
Rat KV1.2 cDNA (NM_012970) was transcribed in vitro to produce full length mRNA. KV1.2 mRNA was injected into Xenopus oocytes and protein expression was verified by detection of voltage evoked Tityustoxin Kα (#STT-360) sensitive ionic current. Membrane fraction was prepared from oocyte population homogenate and lyophilized. Non-injected oocytes underwent the same procedure excluding mRNA injection.

Pharmacological Reagents

κ-Conotoxin RIIIJ Cat #: STC-660

Size: 10 µg MW: 2807.9 Da. Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
30 nM.
Activity
κ-Conotoxin RIIIJ is a blocker of KV1.2 channels1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Dendrotoxin-K Cat #: D-400

Size: 70 µg MW: 6560 Da. Purity: >99% (HPLC) Net peptide content: 100%
Origin
Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba).
Effective concentration
100 nM.
Activity
Dendrotoxin-K is a highly selective blocker of voltage-gated Kchannels (KV1.1 and KV1.2).
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer (pH 7.5). Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
One week at 4°C or six months at -20°C.

MCD peptide Cat #: STM-250

Size: 1 mg MW: 2588 Da. Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
10 nM - 1 μM.
Activity
MCD peptide inhibits KV1.1 and KV1.2 channels1,2.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or six months at -20°C.

Tityustoxin-Kα Cat #: STT-360

Size: 0.5 mg MW: 3942 Da. Purity: >99% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
0.5 - 50 nM.
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.

Note

KV1.2 (KCNA2) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized KV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions