-
New New
This product has recently been released.
Lyophilized Powder Lyophilized Powder
This product is freeze dried. All water molecules have been removed.
Bioassay Tested Bioassay Tested
The activity of this product has been verified and approved by our professional team.
Our Bioassay
Shipped at Room Temp. Shipped at Room Temp.
This lyophilized product is shipped at room temperature. Please see its certificate of analysis for further storage instructions.
100% Net Peptide 100% Net Peptide
This vial contains 100% net peptide content.
Origin Urodacus yaschenkoi (Inland robust scorpion).
Source Synthetic peptide
MW: 4012.7 Da.
Purity: >98%
Formulation Lyophilized powder.
Effective concentration 50 pM – 1 nM.
Sequence GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV.
Modifications Disulfide bonds between Cys5-Cys26, Cys11-Cys31, Cys15-Cys33 and Cys21-Cys36. Val37 - C-terminal amidation.
Molecular formula C161H260N52O50S9.
Activity Urotoxin is a KV1.2 channel potent blocker. The toxin also blocks KV1.1, KV.3 and KCa3.1 channels.
Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
Our bioassay Alomone Labs Urotoxin blocks KV1.2 channels expressed in Xenopus oocytes.
A. Representative time course of Urotoxin (#STU-200) inhibition of KV1.2 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +40 mV every 10 sec, and significantly inhibited by 0.1 nM Urotoxin (green). B. Superimposed traces of KV1.2 current after application of control (black) and of 0.1 nM Urotoxin (green), taken from the recording in A.
References Luna-Ramirez K. et al. (2014)
Mol. Pharmacol. 86, 28.
Yuan, S. et al. (2017)
Toxins (Basel) 9, 11.
Scientific background Urotoxin is a peptide toxin originally isolated from Urodacus yaschenkoi Australian Scorpion venom. Urotoxin is an extremely potent blocker of human voltage-gated potassium channel KV1.2 channels with IC50 values of 160 pM. However, it also displays activity towards KV1.1, KV1.3 and KCa3.1 with IC50 values of 253 nM, 91 nM and 70 nM respectively1.
Potassium channels are membrane proteins found in excitable and nonexcitable cells. KV1.2 channel plays an important role in the maintenance of resting membrane potential and the regulation of the cellular excitability of neurons1,2.
Target KV1.2, KV1.1, KV1.3, KCa3.1 channels
Net Peptide Content: 100%
Lyophilized Powder
Last update: 01/08/2018
Urotoxin (#STU-200) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
