Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Urotoxin

Potassium channel toxin alpha-KTx 6.21
A Super Potent Blocker of KV1.2 Channel
Cat #: STU-200
Alternative Name Potassium channel toxin alpha-KTx 6.21
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4012.7 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 50 pM – 1 nM.
    Sequence GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV.
    Modifications Disulfide bonds between Cys5-Cys26, Cys11-Cys31, Cys15-Cys33 and Cys21-Cys36. Val37 - C-terminal amidation.
    Structure
    Molecular formula C161H260N52O50S9.
    Activity Urotoxin is a potent KV1.2 channel blocker. The toxin also blocks KV1.1, KV.3 and KCa3.1 channels.
    References-Activity
    1. Luna-Ramirez K. et al. (2014) Mol. Pharmacol. 86, 28.
    Accession number P0DL37.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Urotoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      Alomone Labs Urotoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      A. Representative time course of Urotoxin (#STU-200) inhibition of KV1.2 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +40 mV every 10 sec, and significantly inhibited by 0.1 nM Urotoxin (green). B. Superimposed traces of KV1.2 current after application of control (black) and of 0.1 nM Urotoxin (green), taken from the recording in A.
    References - Scientific background
    1. Luna-Ramirez K. et al. (2014) Mol. Pharmacol. 86, 28.
    2. Yuan, S.  et al. (2017) Toxins (Basel) 9, 11.
    Scientific background

    Urotoxin is a peptide toxin originally isolated from Urodacus yaschenkoi Australian Scorpion venom. Urotoxin is an extremely potent blocker of human voltage-gated potassium channel KV1.2 channels with IC50 values of 160 pM. However, it also displays activity towards KV1.1, KV1.3 and KCa3.1 with IC50 values of 253 nM, 91 nM and 70 nM respectively1.

    Potassium channels are membrane proteins found in excitable and nonexcitable cells. KV1.2 channel plays an important role in the maintenance of resting membrane potential and the regulation of the cellular excitability of neurons1,2.

    Target KV1.2, KV1.1, KV1.3, KCa3.1 channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 23/08/2020

    Urotoxin (#STU-200) is a highly pure, synthetic, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    KV1.3 Channels

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us