Lyophilized Powder
Lyophilized Powder
This product is freeze dried. All water molecules have been removed.
Bioassay Tested
Bioassay Tested
The activity of this product has been verified and approved by our professional team.
Our Bioassay
Origin Leiurus quinquestriatus hebraeus (Yellow scorpion).
Source Synthetic peptide
MW: 4296 Da.
Purity: >98% (HPLC)
Effective concentration 10-100 nM.
Sequence ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid.
Structure 
Molecular formula C176H277N57O55S7.
CAS No.: 95751-30-7.
Activity Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.
References - Activity
Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329.
Accession number P13487.
Storage before reconstitution Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
Our bioassay 
Alomone Labs Charybdotoxin inhibits KCa1.1 channels heterologously expressed in Xenopus oocytes.
A. Example of time course showing reversible effect of 20 nM and 50 nM Charybdotoxin (#STC-325) during 100 sec application on the current amplitude. Membrane holding potential was -100 mV stepped to 0 mV during 200 ms following another step to 80 mV during 600 msec. B. Superimposed example traces of KCa1.1 channel currents in response to ramp depolarization before (Control) and during the application of 20 nM or 50 nM of Charybdotoxin for 100 sec.
References - Scientific Background
- Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329.
- Miller, C. et al. (1985) Nature 313, 316.
- Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227.
- Meera, P. et al. (2000) Proc. Natl. Acad. Sci. U.S.A. 97, 5562.
- Sugg, E.E. et al. (1990) J. Biol. Chem. 265, 18745.
Scientific background Charybdotoxin was originally isolated from the venom of the Israeli scorpion Leiurus quinquestriatus hebraeus1. Charybdotoxin blocks KCa1.1 (large conductance Ca2+-activated K+, Slo) channels in nM concentrations2 as well as KV1.2 (Kd, 14 nM) and KV1.3 (Kd, 2.6 nM) channels3. However, experiments with cloned KCa1.1 channels demonstrate the strong effect of the sloβ subunits on the potency of block by Charybdotoxin (see for example4).
Target KCa1.1, KV1.2, KV1.3 K+ channels
Net Peptide Content: 100%
Lyophilized Powder
Image & Title 
Alomone Labs Charybdotoxin blocks BKCa channels in human chorionic plate arterial smooth muscle cells.Inhibition of BKCa channels with Charybdotoxin (#STC-325) which abolished outward currents at +80 mV. Cells were voltage clamped at -60 mV and step depolarised from -70 mV to +80 mV for 500 ms in 10 mV increments and repolarised to -40 mV.Adapted from Brereton, M.F. et al. (2013) PLoS ONE 8, e57451. with permission of PLoS.
Alomone Labs Charybdotoxin blocks BKCa channels in human chorionic plate arterial smooth muscle cells.Inhibition of BKCa channels with Charybdotoxin (#STC-325) which abolished outward currents at +80 mV. Cells were voltage clamped at -60 mV and step depolarised from -70 mV to +80 mV for 500 ms in 10 mV increments and repolarised to -40 mV.Adapted from Brereton, M.F. et al. (2013) PLoS ONE 8, e57451. with permission of PLoS.
Last update: 14/03/2019
Charybdotoxin (#STC-325) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Citations
Product citations
- Fellerhoff-Losch, B. et al. (2015) J. Neural Transm. 123, 137.
- Lee, J. et al. (2014) Develop. Neurobiol. 74, 1.
- Lopez-Gonzalez, I. et al. (2014) Mol. Hum. Reprod. 20, 619.
- Brereton, M.F. et al. (2013) PLoS ONE 8, e57451.
- Cao, Z. et al. (2013) Nat. Commun. 4, 1.
- Chen, M. et al. (2013) Mol. Neurobiol. 48, 794.
- Gonzalez Corrochano, R. et al. (2013) Br. J. Pharmacol. 169, 449.
- Cosyns, S.M. and Lefebvre, R.A. (2012) Eur. J. Pharmacol. 686, 104.
- Sun, P. et al. (2011) J. Neurosci. 31, 16464.
- Tanner, G.R. et al. (2011) J. Neurosci. 31, 8689.
- Malinina, E. et al. (2010) J. Neurophysiol. 104, 200.
- Sciaccaluga, M. et al. (2010) Am. J. Physiol. 299, C175.
- Dhaese, I. and Lefebvre, R.A. (2009) Eur. J. Pharmacol. 606, 180.
- Begg, M. et al. (2001) J. Physiol. 531, 95.