Overview
Type: GST fusion protein
Form: Lyophilized powder
Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010) is the original antigen used for immunization during Anti-KV1.2 (KCNA2) Antibody (#APC-010) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.2/KCNA2 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200).
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
Western blot analysis of rat heart membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200)
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
Multiplex staining of KV1.2 and KV1.1 in mouse cerebellumImmunohistochemical staining of mouse perfusion-fixed frozen brain sections using Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:300) and Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR), (1:100). A. KV1.2 staining, followed by donkey-anti-rabbit-Cy2 (green). B. KV1.1 staining (red). C. Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows), where no KV1.2 expression is observed.- Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
Properties
Sequence
- GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142).
Accession (Uniprot) Number P63142
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
