Overview
Type: GST fusion protein
Form: Lyophilized powder
Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002) is the original antigen used for immunization during Anti-KV1.3 (KCNA3) Antibody (#APC-002) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.3/KCNA3 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).
2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002).- Rat brain sections.
Properties
Sequence
- GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001).
Accession (Uniprot) Number P22001
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
