Free shipping starts now, no minimum, no coupons required!

Anti-KV1.3 (KCNA3) Antibody

Potassium voltage-gated channel subfamily A member 3

Cat #: APC-002
Alternative Name Potassium voltage-gated channel subfamily A member 3
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
  • GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Accession (Uniprot) Number P22001
Gene ID 3738
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Rat, rabbit, mouse - identical.
RRID AB_2040151.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.6 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).
    2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002).
  • Human CD3+ cells (Szigligeti, P. et al. (2006) J. Physiol. 573, 357.).
  • Transfected HEK-293 cell lysate (Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.).
  • Rat brain sections.
  • Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem99, 426.).
  1. Chandy, K.G. et al. (2001) Toxicon 39, 1269.
  2. Koo, G.C. et al. (1997) J. Immunol. 158, 5120.
  3. Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227.
  4. Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866.
  5. Garcia, M.L. et al. (1994) Biochemistry 33, 6834.
  6. Koschak, A. et al. (1998) J. Biol. Chem. 273, 2639.
  7. Kalman, K. et al. (1998) J. Biol. Chem. 273, 32697.
Scientific background

KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel, encoded by KCNA3, is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. The prominence of KV1.3 channels in these cells (particularly in T lymphocytes) directed much research attention. It was found that KV1.3 is the main channel responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2 Based on the central role of KV1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1

KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (2.6 nM), Noxiustoxin (1 nM), Kaliotoxin (0.65 nM), Margatoxin (0.05 nM), Agitoxin-1 (1.7 nM), Agitoxin-2 (0.004 nM), Hongotoxin-1 (0.09 nM)  and Stichodactyla toxin (0.01 nM).3-7

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Last update: 11/04/2021

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of human KV1.3. Anti-KV1.3 (KCNA3) Antibody (#APC-002) can be used in western blot, immunoprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.3 potassium channel from human, rat, and mouse samples.

For research purposes only, not for human use



Scientific Background


Western blot citations
  1. Mouse activated macrophages (BMDM cells).
    Moreno, C. et al. (2013) J. Immunol. 191, 6136.
  2. Human CD3+ cells.
    Szigligeti, P. et al. (2006) J. Physiol. 573, 357.
Immunoprecipitation citations
  1. Transfected HEK-293 cell lysate.
    Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.
Immunohistochemistry citations
  1. Human brain sections (1:100).
    Chen, Y.J. et al. (2016) J. Cereb. Blood Flow Metab. 36, 2146.
  2. Rat lumbar spinal cord sections.
    Wolff, M. et al. (2016) Neurosci. Res. 109, 16.
  3. Mouse brain sections (1:300).
    Blosa, M. et al. (2015) J. Physiol. 593, 4341.
  4. Human artery tissues (1:50).
    Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol. 654, 266.
Immunocytochemistry citations
  1. Human peripheral blood mononuclear cells (PBMCs).
    Hu, L. et al. (2013) PLoS ONE 8, e54267.
  2. Rat neural progenitor cells (NPCs) (1:200).
    Liebau, S. et al. (2006) J. Neurochem. 99, 426.
More product citations
  1. Rus, H. et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 11094.
  2. Conforti, L. et al. (2003) J. Immunol. 170, 695.
  3. Ishikawa, T. et al. (2003) J. Neurosci. 23, 10445.
  4. Koni, P.A. et al. (2003) J. Biol. Chem. 278, 39443.
  5. Vicente, R. et al. (2003) J. Biol. Chem. 278, 46307.
  6. Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
  7. Chung, Y.H. et al. (2000) Brain Res. 875, 164.
  8. Desai, R. et al. (2000) J. Biol. Chem. 275, 39954.
  9. Xu, C. et al. (1999) Am. J. Physiol. 277, G1055.
  10. Greffrath, W. et al. (1998) J. Physiol. 513, 493.
  11. Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
Shipping and Ordering information