Anti-KV1.3

Kcna3
    Cat #: APC-002
    Sizes: 25 µl, 50 µl, 0.2 ml
  • Lyophilized Powder
  • Antigen Incl.
  • QC Tested
  • Shipped at Room Temp.
  • Type: Polyclonal
    Source: Rabbit
    Reactivity: h, m, r
    Immunogen
    GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3 (Accession P22001). Intracellular, C-terminus.
    Accession (Uniprot) Number 3738
    Gene ID P22001
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Rat, rabbit, mouse - identical.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST-fusion protein. The antibody was then affinity purified on immobilized Kv1.3-GST.
    Formulation Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.6 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Control antigen reconstitution 100 μl PBS.
    Control antigen storage after reconstitution -20ºC.
    Preadsorption Control 3 µg fusion protein per 1 µg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ic, ih, ip, wb
    May also work in: ifc*
    Western blot
    Western blot analysis of rat brain membranes:
    1. Anti-Kv1.3 antibody (#APC-002), (1:200).
    2. Anti-Kv1.3 antibody, preincubated with the control peptide antigen.
    Human CD3+ cells (see Szigligeti, P. et al. (2006) J. Physiol. 573, 357).
    Immunoprecipitation
    Transfected HEK-293 cell lysate (see Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675).
    Immunohistochemistry
    Rat brain sections.
    Immunocytochemistry
    Rat neural progenitor cells (NPCs) (1:200) (see Liebau, S. et al. (2006) J. Neurochem. 99, 426).
    References
    1. Chandy, K.G. et al. (2001) Toxicon 39, 1269.
    2. Koo, G.C. et al. (1997) J. Immunol. 158, 5120.
    3. Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227.
    4. Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866.
    5. Garcia, M.L. et al. (1994) Biochemistry 33, 6834.
    6. Koschak, A. et al. (1998) J. Biol. Chem. 273, 2639.
    7. Kalman, K. et al. (1998) J. Biol. Chem. 273, 32697.
    Scientific background

    KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. It is in these cells (particularly T lymphocytes) that KV1.3 function has centered a lot of attention. It was found that KV1.3 is the main channel.

    Responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2  

    Based on the central role of Kv1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1 

    KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (#STC-325, 2.6 nM), Noxiustoxin (#STN-340, 1 nM), Kaliotoxin (#STK-370, 0.65 nM), Margatoxin (#STM-325, 0.05 nM), Agitoxin-1 (#RTA-150, 1.7 nM), Agitoxin-2 (#STA-420, 0.004 nM), Hongotoxin-1 (#RTH-400, 0.09 nM)  and Stichodactyla toxin (#STS-400, 0.01 nM).3-7

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, IC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IH- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Last update: 20/02/2018

    Alomone Labs  is pleased to offer a highly specific antibody directed against an epitope of human KV1.3. Anti-KV1.3 antibody (#APC-002) can be used in western blot, immunoprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.3 from human, rat, and mouse samples.

     

    For research purposes only, not for human use

    For a list of product citations in the literature, see “product citations” below. If you know of additional relevant citations for this product, please let us know.

    Citations
    Western blot citations
    1. Mouse activated macrophages (BMDM cells).
      Moreno, C. et al. (2013) J. Immunol. 191, 6136.
    2. Human CD3+ cells.
      Szigligeti, P. et al. (2006) J. Physiol. 573, 357.
    Immunoprecipitation citations
    1. Transfected HEK-293 cell lysate.
      Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.
    Immunohistochemistry citations
    1. Human brain sections (1:100).
      Chen, Y.J. et al. (2016) J. Cereb. Blood Flow Metab. In press.
    2. Rat lumbar spinal cord sections.
      Wolff, M. et al. (2016) Neurosci. Res. 109, 16.
    3. Mouse brain sections (1:300).
      Blosa, M. et al. (2015) J. Physiol. 593, 4341.
    4. Human artery tissues (1:50).
      Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol.  654, 266.
    Immunocytochemistry citations
    1. Human peripheral blood mononuclear cells (PBMCs).
      Hu, L. et al. (2013) PLoS ONE 8, e54267.
    2. Rat neural progenitor cells (NPCs) (1:200).
      Liebau, S. et al. (2006) J. Neurochem99, 426.
    More product citations
    1. Rus, H. et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 11094.
    2. Conforti, L. et al. (2003) J. Immunol. 170, 695.
    3. Ishikawa, T. et al. (2003) J. Neurosci. 23, 10445.
    4. Koni, P.A. et al. (2003) J. Biol. Chem. 278, 39443.
    5. Vicente, R. et al. (2003) J. Biol. Chem. 278, 46307.
    6. Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
    7. Chung, Y.H. et al. (2000) Brain Res. 875, 164.
    8. Desai, R. et al. (2000) J. Biol. Chem. 275, 39954.
    9. Xu, C. et al. (1999) Am. J. Physiol277, G1055.
    10. Greffrath, W. et al. (1998) J. Physiol. 513, 493.
    11. Yuan, X.J. et al. (1998) Am. J. Physiol274, L621.
    Related Products
    Control expreriments
    1. Anti-KV1.3 (extracellular) antibody (#APC-101).
      This antibody recognizes a different epitope and thus can also be used as a control for detecting KV1.3.
    Immuno-Colocalization experiments
    1. Guinea pig Anti-KV1.3 (extracellular) antibody (#AGP-005) is raised in guinea pig and can be used in immuno-colocalization studies in conjunction with any of our antibodies raised in rabbit. This antibody has been raised against the same epitope as #APC-101.
    2. Anti-KV1.3 (extracellular)-Biotin antibody (#APC-101-B).
      A biotin labeled primary antibody. It can be used in immuno-colocalization studies in conjunction with any of our antibodies raised in rabbit.
    Live cell imaging experiments
    1. Anti-KV1.3 (extracellular) antibody (#APC-101).
      This antibody recognizes an extracellular epitope and can be used to detect KV1.3 in live cells. This antibody has been raised against the same epitope as #AGP-005.
    2. Guinea pig Anti-KV1.3 (extracellular) antibody (#AGP-005) is raised in guinea pig and can be used in colocalization studies in conjunction with any of our antibodies raised in rabbit. This antibody has been raised against the same epitope as #APC-101.
    3. Anti-KV1.3 (extracellular)-FITC antibody (#APC-101-F).
      A fluorescent labeled primary antibody. It can be used to detect KV1.3 in live cells.
    4. Anti-KV1.3 (extracellular)-Biotin antibody (#APC-101-B).
      A biotin labeled primary antibody. This antibody is the biotin-labeled version of #APC-101 and is ideal to detect KV1.3 in live cells.