- GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
- Western blot analysis of rat brain membranes:1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).
2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002). - Human CD3+ cells (Szigligeti, P. et al. (2006) J. Physiol. 573, 357.).
- Transfected HEK-293 cell lysate (Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.).
- Rat brain sections.
- Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem. 99, 426.).
- Chandy, K.G. et al. (2001) Toxicon 39, 1269.
- Koo, G.C. et al. (1997) J. Immunol. 158, 5120.
- Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227.
- Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866.
- Garcia, M.L. et al. (1994) Biochemistry 33, 6834.
- Koschak, A. et al. (1998) J. Biol. Chem. 273, 2639.
- Kalman, K. et al. (1998) J. Biol. Chem. 273, 32697.
KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel, encoded by KCNA3, is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. The prominence of KV1.3 channels in these cells (particularly in T lymphocytes) directed much research attention. It was found that KV1.3 is the main channel responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2 Based on the central role of KV1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1
KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (2.6 nM), Noxiustoxin (1 nM), Kaliotoxin (0.65 nM), Margatoxin (0.05 nM), Agitoxin-1 (1.7 nM), Agitoxin-2 (0.004 nM), Hongotoxin-1 (0.09 nM) and Stichodactyla toxin (0.01 nM).3-7
Application key:
Species reactivity key:
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of human KV1.3. Anti-KV1.3 (KCNA3) Antibody (#APC-002) can be used in western blot, immunoprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.3 potassium channel from human, rat, and mouse samples.
Applications
Citations
- Mouse activated macrophages (BMDM cells).
Moreno, C. et al. (2013) J. Immunol. 191, 6136. - Human CD3+ cells.
Szigligeti, P. et al. (2006) J. Physiol. 573, 357.
- Transfected HEK-293 cell lysate.
Vicente, R. et al. (2006) J. Biol. Chem. 281, 37675.
- Human brain sections (1:100).
Chen, Y.J. et al. (2016) J. Cereb. Blood Flow Metab. 36, 2146. - Rat lumbar spinal cord sections.
Wolff, M. et al. (2016) Neurosci. Res. 109, 16. - Mouse brain sections (1:300).
Blosa, M. et al. (2015) J. Physiol. 593, 4341. - Human artery tissues (1:50).
Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol. 654, 266.
- Human peripheral blood mononuclear cells (PBMCs).
Hu, L. et al. (2013) PLoS ONE 8, e54267. - Rat neural progenitor cells (NPCs) (1:200).
Liebau, S. et al. (2006) J. Neurochem. 99, 426.
- Rus, H. et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 11094.
- Conforti, L. et al. (2003) J. Immunol. 170, 695.
- Ishikawa, T. et al. (2003) J. Neurosci. 23, 10445.
- Koni, P.A. et al. (2003) J. Biol. Chem. 278, 39443.
- Vicente, R. et al. (2003) J. Biol. Chem. 278, 46307.
- Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
- Chung, Y.H. et al. (2000) Brain Res. 875, 164.
- Desai, R. et al. (2000) J. Biol. Chem. 275, 39954.
- Xu, C. et al. (1999) Am. J. Physiol. 277, G1055.
- Greffrath, W. et al. (1998) J. Physiol. 513, 493.
- Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
Specifications
Scientific Background
Related Products
- Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101). This antibody recognizes a different epitope and thus can also be used as a control for detecting KV1.3.
- Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101-GP) is raised in guinea pig and can be used in multiplex staining studies in conjunction with any of our antibodies raised in rabbit. This antibody has been raised against the same epitope as #APC-101.
- Anti-KV1.3 (KCNA3) (extracellular)-Biotin Antibody (#APC-101-B). A biotin labeled primary antibody. It can be used in multiplex staining studies in conjunction with any of our antibodies raised in rabbit.
- Anti-KV1.3 (KCNA3) (extracellular)-FITC Antibody (#APC-101-F). This FITC-conjugated antibody can be used to detect KV1.3 in live cell flow cytometry.
- Anti-KV1.3 (KCNA3) (extracellular)-PE Antibody (#APC-101-PE). This R-PE-conjugated antibody can be used to detect KV1.3 in live cell flow cytometry.
- Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101). This antibody recognizes an extracellular epitope and can be used to detect KV1.3 in live cells. This antibody has been raised against the same epitope as #APC-101-GP.
- Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101-GP) is raised in guinea pig and can be used in colocalization studies in conjunction with any of our antibodies raised in rabbit. This antibody has been raised against the same epitope as #APC-101.
- Anti-KV1.3 (KCNA3) (extracellular)-FITC Antibody (#APC-101-F). A fluorescent labeled primary antibody. It can be used to detect KV1.3 in live cells.
- Anti-KV1.3 (KCNA3) (extracellular)-Biotin Antibody (#APC-101-B). A biotin labeled primary antibody. This antibody is the biotin-labeled version of #APC-101 and is ideal to detect KV1.3 in live cells.
Antibodies
Pharmacological tools
- Aa1 Toxin (#RTA-400)
- ADWX-1 (#STW-100)
- Agitoxin-2 (#STA-420)
- Agitoxin-2-Cys-TAMRA (#RTA-420-T)
- Charybdotoxin (#STC-325)
- HsTx1 Toxin (#STH-300)
- Kaliotoxin-1 (#STK-370)
- Margatoxin (#STM-325)
- Noxiustoxin (#STN-340)
- ShK (Stichodactyla Toxin) (#STS-400)
- Stichodactyla Toxin-Biotin (#STS-400-B)
- Spinoxin (#STS-500)
Explorer kits & Research packs
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us