Overview
Type: GST fusion protein
Form: Lyophilized powder
A Blocking peptide for Anti-KV1.4 Antibody (#APC-007). Intended to be used as a negative control.
Applications: bl
For research purposes only, not for human use
Applications
Blocking
Western blot analysis of rat brain membranes:1. Anti-KV1.4 Antibody (#APC-007), (1:200).
2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007).- Rat brain sections (see also references 7-9 in publications using this product).
Properties
Sequence
- GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385).
Accession (Uniprot) Number P15385
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
