- GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
- Western blot analysis of rat brain membranes:1. Anti-KV1.4 Antibody (#APC-007), (1:200).
2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007). - Human left heart ventricle (1:50-1:100) (Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.).
- Rat brain sections (see also references 7-9 in publications using this product).
- Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem. 99, 426.).
- Stuhmer, W. et al. (1989) EMBO J. 8, 3235.
- Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473.
- Bogin, O. (2006) Modulator 21, 28.
KV1.4 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2
A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.
The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2
The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.
KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the “classical” non-selective potassium channel blockers.
Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards KV1.1 and KV1.3, is still a potent inhibitor of KV1.4 channels.3
Application key:
Species reactivity key:
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat KV1.4. Anti-KV1.4 Antibody (#APC-007) can be used in western blot, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.4 from human, rat and mouse samples.
Applications
Citations
- Mouse cardiac HL-1 cell lysate.
Lu, Y.Y. et al. (2016) J. Cell. Mol. Med. 20, 1182. - Rat ventricular myocytes (1:200).
Liu, W.J. et al. (2015) Am. J. Physiol. 309, H1288. - Rat heart lysate.
Hsueh, C.H. et al. (2014) J. Am. Soc. Nephrol. 25, 2812.
- Rat DRGs.
Takahashi, R. et al. (2013) J. Urol. 190, 2296.
- Riley, D. et al. (2010) J. Appl. Physiol. 108, 1003.
- Hayashi, Y. et al. (2009) Am J. Physiol. 296, R1661.
- Herrero-Herranz, E. et al. (2007) Am. J. Pathol. 171, 589.
- Sonner, P.M. and Stern, J.E. (2007) J. Physiol. 582, 1219.
- Liebau, S. et al. (2006) J. Neurochem. 99, 426.
- Rose, J. et al. (2005) Am. J. Physiol. 288, H2077.
- Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.
- Wang, J. et al. (2005) Am. J. Physiol. 288, L1049.
- Xu, Y. et al. (2005) J. Physiol. 562.3, 745.
- Xia, F. et al. (2004) J. Biol. Chem. 279, 24685.
- Dodson, P.D. et al. (2003) J. Physiol. 550.1, 27.
- Aydar, E. et al. (2002) Neuron 34, 399.
- Dodson, P.D. et al. (2002) J. Neuroscience 22, 6953.
- Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
- MacDonald, P.E. et al. (2002) Diabetes 51, 443.
- MacDonald, P.E. et al. (2002) J. Biol. Chem. 277, 44938.
- Chung, Y.H. et al. (2000) Brain Res. 875, 164.
- Gopel, S.O. et al. (2000) J. Physiol. 528.3, 497.
- Mienville, J.M. et al (1999) J. Neurophysiol. 82, 1303.
- Guo, W. et al. (1998) J. Mol. Cell Cardiol. 30, 1449.
- Meiri, N. et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95, 15037.
- Sobko, A. et al. (1998) J. Neurosci. 18, 10398.
- Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
- Attali, B. et al. (1997) J. Neurosci. 17, 8234.
- Guo, W. et al. (1997) Eur. J. Physiol. 434, 206.
Specifications
Scientific Background
Related Products
- Anti-KV1.4 (extracellular) Antibody (#APC-167).
This antibody recognizes a different epitope, and thus can also be used as a control for detecting KV1.4.
- Anti-KV1.4 (extracellular) Antibody (#APC-167).
This antibody recognizes an extracellular epitope and can be used to detect KV1.4 in live cells.
Antibodies
Pharmacological tools
Explorer kits & Research packs
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us