Free shipping starts now, no minimum, no coupons required!

Anti-KV1.4 Antibody

Potassium voltage-gated channel subfamily A member 4, KCNA4
Cat #: APC-007
Alternative Name Potassium voltage-gated channel subfamily A member 4, KCNA4
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GGST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Accession (Uniprot) Number P15385
Gene ID 25469
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.
RRID AB_2040153.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.3 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, wb
May also work in: ifc*, ip*
Western blot
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.4 Antibody (#APC-007), (1:200).
    2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007).
  • Human left heart ventricle (1:50-1:100) (Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.).
Immunohistochemistry
  • Rat brain sections (see also references 7-9 in publications using this product).
Immunocytochemistry
  • Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem99, 426.).
References
  1. Stuhmer, W. et al. (1989) EMBO J. 8, 3235.
  2. Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473.
  3. Bogin, O. (2006) Modulator 21, 28.
Scientific background

KV1.4 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2

The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the “classical” non-selective potassium channel blockers.

Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards KV1.1 and KV1.3, is still a potent inhibitor of KV1.4 channels.3

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Last update: 16/08/2020

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat KV1.4. Anti-KV1.4 Antibody (#APC-007) can be used in western blot, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.4 from human, rat and mouse samples.

For research purposes only, not for human use

Applications

Specifications

Scientific Background

Citations

Citations
Western blot citations
  1. Mouse cardiac HL-1 cell lysate.
    Lu, Y.Y. et al. (2016) J. Cell. Mol. Med. 20, 1182.
  2. Rat ventricular myocytes (1:200).
    Liu, W.J. et al. (2015) Am. J. Physiol. 309, H1288.
  3. Rat heart lysate.
    Hsueh, C.H. et al. (2014) J. Am. Soc. Nephrol. 25, 2812.
Immunohistochemistry citations
  1. Rat DRGs.
    Takahashi, R. et al. (2013) J. Urol. 190, 2296.
More product citations
  1. Riley, D. et al. (2010) J. Appl. Physiol. 108, 1003.
  2. Hayashi, Y. et al. (2009) Am J. Physiol. 296, R1661.
  3. Herrero-Herranz, E. et al. (2007) Am. J. Pathol. 171, 589.
  4. Sonner, P.M. and Stern, J.E. (2007) J. Physiol. 582, 1219.
  5. Liebau, S. et al. (2006) J. Neurochem. 99, 426.
  6. Rose, J. et al. (2005) Am. J. Physiol. 288, H2077.
  7. Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.
  8. Wang, J. et al. (2005) Am. J. Physiol. 288, L1049.
  9. Xu, Y. et al. (2005) J. Physiol. 562.3, 745.
  10. Xia, F. et al. (2004) J. Biol. Chem. 279, 24685.
  11. Dodson, P.D. et al. (2003) J. Physiol. 550.1, 27.
  12. Aydar, E. et al. (2002) Neuron 34, 399.
  13. Dodson, P.D. et al. (2002) J. Neuroscience 22, 6953.
  14. Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
  15. MacDonald, P.E. et al. (2002) Diabetes 51, 443.
  16. MacDonald, P.E. et al. (2002) J. Biol. Chem. 277, 44938.
  17. Chung, Y.H. et al. (2000) Brain Res. 875, 164.
  18. Gopel, S.O. et al. (2000) J. Physiol. 528.3, 497.
  19. Mienville, J.M. et al (1999) J. Neurophysiol. 82, 1303.
  20. Guo, W. et al. (1998) J. Mol. Cell Cardiol. 30, 1449.
  21. Meiri, N. et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95, 15037.
  22. Sobko, A. et al. (1998) J. Neurosci. 18, 10398.
  23. Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
  24. Attali, B. et al. (1997) J. Neurosci. 17, 8234.
  25. Guo, W. et al. (1997) Eur. J. Physiol. 434, 206.
Shipping and Ordering information