Free shipping starts now, no minimum, no coupons required!

Muscarinic Toxin 7

Muscarinic toxin-7, MT7, muscarinic m1-toxin, m1-toxin1
An Antagonist of M1 Muscarinic Receptor
Cat #: STM-200
Alternative Name Muscarinic toxin-7, MT7, muscarinic m1-toxin, m1-toxin1
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 7472 Da.
    Purity: >98% (HPLC)
    Effective concentration 1-100 nM.
    Sequence LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK.
    Modifications Disulfide bonds between Cys3-Cys24, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63.
    Structure
    Molecular formula C322H484N90O98S9.
    CAS No.: 135541-77-4.
    Activity Uncompetitive antagonist of M1 AChR1.
    References-Activity
    1. Olianas, M.C. et al. (2000) Br. J. Pharmacol. 131, 447.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer, pH > 8. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4ֲ°C or three months at -20ֲ°C.
    Our bioassay
    • Alomone Labs Muscarinic Toxin 7 inhibits Carbachol-evoked [Ca2+]in increase in M1R-expressing C6 cells.
      Alomone Labs Muscarinic Toxin 7 inhibits Carbachol-evoked [Ca2+]in increase in M1R-expressing C6 cells.
      Cells were loaded with Fluo-3 AM and pre-incubated for 20 min with control or with 25 nM and 100 nM Muscarinic Toxin 7 (#STM-200), as indicated, and stimulated with 100 µM Carbachol (arrow). Changes in intracellular Ca2+ were detected as changes in Fluo-3 emission following stimulation.
    References - Scientific background
    1. Felder, C.C. et al. (2000) J. Med. Chem43, 4333.
    2. Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol26, 298.
    3. Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav74, 411.
    4. Van der Zee, E.A. et al. (1999) Prog. Neurol58, 409.
    5. Adem, A. and Karlsson, E. (1997) Life Sci. 60, 1069.
    6. Olianas, M.C. et al. (2000) Br. J. Pharmacol. 131, 447.
    7. Kukkonen, A. et al. (2004) J. Biol. Chem. 279, 50923.
    Scientific background

    The action of the neurotransmitter acetylcholine (Ach) is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned: m1-m51,2.

    The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues1,2.

    Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control1. They also participate in learning and memory processing3,4.

    Muscarinic Toxin 7 is a 65 amino acid peptide toxin isolated from the Dendroaspis angusticeps (Eastern green mamba)5. It was first found to inhibit M1 muscarinic receptors stably transfected in CHO cells at very low concentrations (1-30 nM)6 and acts as a non-competitive antagonist by binding to an allosteric site6.

    Muscarinic Toxin 7 binding studies using a M1 and M3 chimera demonstrated that the high affinity of Muscarinic Toxin 7 towards M1 receptor is due to only three residues located in the 2nd and 3rd extracellular loops of the receptor7.

    Target M1 muscarinic receptor
    Net Peptide Content: 100%
    Last update: 23/08/2020

    Muscarinic Toxin 7 (#STM-200) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Product citations
    1. Hernández-Martínez, R. et al. (2015) J. Neurophysiol. 113, 796.
    Shipping and Ordering information