Name: κ-Bungarotoxin
Brand: Alomone Labs
SKU: B-300

Cat #: B-300

Alternative Name kappa-Bungarotoxin, Kappa-bgt, Kappa-1-bungarotoxin, Long neurotoxin 2,
Neuronal bungarotoxin, nBgt, Toxin F

Lyophilized Powder yes

Bioassay Tested

Origin Bungarus multicinctus (Many-banded krait)

Source Natural peptide

MW: 7265 Da

Purity: >98%

Form Lyophilized Powder

Effective concentration 5 -25 nM

Sequence RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCT TDNCNH-OH

Modifications Disulfide bonds location- Cys³-Cys²¹, Cys¹⁴-Cys⁴², Cys²⁷-Cys³¹, Cys⁴⁶-Cys⁵⁸, Cys⁵⁹-Cys⁶⁴

Structure

Molecular formula C₃₀₃H₄₇₅N₉₁O₉₇S₁₀

Activity Kappa-bungarotoxin is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of most α3-containing and some α4-containing nAChRs subunits¹.

References-Activity

Chiappinelli, V. A. et al. (1996) Toxicon, 34, 1243.

Accession number P01398

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.

Solubility Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles. Centrifuge all product preparations before use (10,000 g for 1 min).

Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C.

Our bioassay

Alomone Labs κ-Bungarotoxin inhibits α3/β2 nAChRs expressed in Xenopus oocytes.
A. Representative time course of α3/β2 current inhibition by 25 nM κ-Bungarotoxin (#B-300). Currents were elicited every 50 sec by transient applications of 20 µM ACh, while membrane potential was held at -80 mV, and inhibited by 25 nM (green) κ-Bungarotoxin.
B. Superimposed traces of α3/β2 currents evoked by ACh (arrow) after application of control (black) and 25 nM (green) κ-Bungarotoxin (taken from the recording in A).

References - Scientific background

Chiappinelli, V. A. (1983) Brain Res., 277, 9.
Grant, G. A. and Chiappinelli, V.A. (1985) Biochemistry, 24, 1532.
Chiappinelli, V. A. et al. (1996) Toxicon, 34, 1243.
Chiappinelli, V. A. and Lee, J.C. (1985) J. Biol. Chem., 260, 6182.
Grant, G.A. et al. (1997) Biochemistry, 36, 3353.
Osipov, A.V. et al. (2008) J. Biol. Chem., 283, 14571.
Ho, T.N.T. et al. (2020) Front. Neurosci., 14, 609005.

Scientific background

Kappa-bungarotoxin (κ-Bungarotoxin, κ-Bgt) is a 66 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus^1,2. κ-Bgt is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of α3-containing and some α4-containing nAChRs subunits³.

Under physiological solvent conditions, κ-Bungarotoxin exists as a non-covalent homodimer⁴. The dimeric nature of the toxin may play a crucial role in the binding properties of κ-Bgt to neuronal types of AChRs while losing its potency on muscle receptors^4-6.

Neuronal nicotinic acetylcholine receptors (nAChRs) are prototypical cation-selective, ligand-gated ion channels that mediate fast neurotransmission in the central and peripheral nervous systems. nAChRs are involved in a range of physiological and pathological functions and hence are important therapeutic targets⁷. The κ-neurotoxins have been valuable pharmacological tools in the study of neuronal AChRs³.

Target α3/β2 Neuronal nAChR

Peptide Content: 100%

Lyophilized Powder

Widget not in any sidebars

Last update: 06/11/2022

κ-Bungarotoxin (#B-300) is a highly pure, natural, and biologically active peptide toxin.

Order Summary

κ-Bungarotoxin

Applications

Citations

Specifications

Scientific Background

Related Products

Need Help With This Product?