BomoTx

BomoTx, BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist
  • New
Cat #: NTB-200
Sizes: 35 µg, 70 µg, 0.14 mg
  • Lyophilized Powder
  • Shipped at Room Temp.
  • 100% Net Peptide
  • Origin Brazilian lancehead pit viper (Bothrops moojeni).
    Source: Natural
    MW: 13,834 Da.
    Purity >99%.
    Formulation Lyophilized powder.
    Effective concentration 1 µM.
    Sequence SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCKKADPC.
    Molecular formula C598H942N166O181S15.
    Activity BomoTx excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
    Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
    References
    1. Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524.
    2. Pasqualetto, G. et al. (2018) Front. Pharmacol. 9, 58.
    Scientific background

    BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally from the Brazilian lancehead pit viper. This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.

    BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.

    P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1–P2X72.

    Net Peptide Content: 100%
    Last update: 15/04/2018

    BomoTx (#NTB-200) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use