BomoTx

BomoTx, BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist
    Cat #: NTB-200
  • Lyophilized Powder
  • Shipped at Room Temp.
  • 100% Net Peptide
  • Origin Brazilian lancehead pit viper (Bothrops moojeni).
    Source Natural
    MW: 13,834 Da.
    Purity: >99% (HPLC)
    Formulation Lyophilized powder.
    Effective concentration 1 µM.
    Sequence SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCKKADPC.
    Modifications The exact location of the disulphide bridges is currently unknown.
    Structure

    The exact location of the disulphide bridges is currently unknown.
    Molecular formula C598H942N166O181S15.
    Activity BomoTx excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
    Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
    References
    1. Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524.
    2. Pasqualetto, G. et al. (2018) Front. Pharmacol. 9, 58.
    Scientific background

    BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.

    BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.

    P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1–P2X72.

    Target P2X2/P2X3 receptors
    Net Peptide Content: 100%
    Image & Title

    BomoTx
    BomoTx-induced currents are mediated by ATP.A. Representative current–voltage relationship of BomoTx-evoked conductance from transiently activated TG neurons demonstrates inwardly rectified currents that reverse at 0 mV. B. Representative whole-cell voltage-clamp experiments on TG neurons showing that Ro51 (a P2X3 receptor antagonist) blocks BomoTx-evoked current. C. BomoTx does not directly activate HEK cells expressing rat P2X2, P2X3, or P2X2/3 channels.Adapted from Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524. with permission of the National Academy of Sciences.

    Last update: 14/10/2018

    BomoTx (#NTB-200) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use