Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Ergtoxin-1

K+ channel toxin γ-KTx 1.1, CnErg1, CnErgTx1, ErgTx1, ErgTx
A Novel Blocker of ERG1 (KV11.1) K+ Channel
    Cat #: STE-450
    Alternative Name K+ channel toxin γ-KTx 1.1, CnErg1, CnErgTx1, ErgTx1, ErgTx
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Synthetic peptide
    MW: 4730 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 10-100 nM.
    Sequence DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA.
    Modifications Disulfide bonds between Cys5-Cys23, Cys11-Cys34, Cys20-Cys39, and Cys24-Cys41.
    Structure
    • Ergtoxin-1
    Molecular formula C193H295N59O63S9.
    CAS No.: 8006-25-5.
    Activity Ergtoxin-1 is a potent inhibitor of ERG K+ channels of nerve, heart and endocrine cells of different species1,2.
    References-Activity
    1. Scaloni, A. et al. (2000) FEBS Lett. 479, 156.
    2. Gurrola, G.B. et al. (1999) FASEB. J. 13, 953.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Ergtoxin-1
      Alomone Labs Ergtoxin-1 inhibits the current of KV11.1 (hErg) channels expressed in Xenopus oocytes.
      A. Representative time course of KV11.1 current inhibition by 50 nM Ergtoxin-1 (#STE-450), as indicated (green). B. Superimposed traces of KV11.1 current after application of control solution (black) and of 50 nM Ergtoxin-1 (green), taken from the recording in A. Membrane potential was held at -100 mV. Current was elicited every 10 sec by a 200 ms voltage step to +40 mV, followed by a 200 ms step to -40 mV (as shown below).
    References - Scientific background
    1. Scaloni, A. et al. (2000) FEBS Lett. 479, 156.
    2. Gurrola, G.B. et al. (1999) FASEB. J. 13, 953.
    Scientific background

    Ergtoxin-1 was originally isolated from Centruroides noxius scorpion venom.

    The peptide toxin specifically blocks KV11.1 (ERG) K+ channels in different tissues and across species1,2. Patch clamp recordings from cultured cell lines and cardiac myocytes showed specific blocking of ERG currents with an IC50 of 16 nM, and increased firing rate in neurons as well as cardiac action potential broadening1,2.

    Target KV11.1 K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    receive a 0.1 mg free trial sample!
    Last update: 24/01/2020

    Ergtoxin-1 (#STE-450) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Electrophysiology
    1. HEK 293 cells stably transfected with HERG (whole cell patch clamp).
      Milnes, J.T. et al. (2003) FEBS Lett. 547, 20.

    Related Products

    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us