Recombinant human NGF proDomain protein

Human NGF proDomain, Recombinant, E. coli
Cat #: N-290
  • Lyophilized Powder
  • Sterile & Endotoxin Free
  • Source Recombinant, E. coli
    MW: 11.6 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Sequence MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKR.
    Activity proNGF is the preferred ligand of p75NTR 1. In contrast to its mature form proNGF induces apoptosis via p75NTR 1, but can also mediate cell survival in DRGs2.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water, DMEM at a concentration of at least 10 µg/ml. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • NGF is a key factor in the survival and differentiation of neurons in the peripheral and central nervous systems. Like many other neurotrophins, mature NGF arises from the proteolytic cleavage of its precursor form (proNGF) by various proteases. It has been found that proNGF, and not mature NGF, is the predominant isoform found in the human brain as well as in a variety of cell types, including mast cells, sciatic nerve cells, thyroid gland, skeletal muscle, prostate gland, hippocampus and hair follicle.4 The mouse salivary gland is the most abundant source of mature NGF. NGF can be secreted as proNGF or mature NGF, each with distinct binding preferences for p75NTR, Trk-family receptors and sortilin.1-3

        In many cases, the full prodomain region derived from the precursor has biological functions, for instance; the prodomain of the transforming growth factor β (TGFβ) affects the dimerization and folding as well as the activity of the mature proteins via non-covalent association. The propeptide of the bone morphogenetic proteins BMP-4 and BMP-7 regulates the diffusion and distribution of these growth factors within the extracellular matrix.4,5 However, the role of the full NGF-prodomain, which is a proteolytic cleavage product of the proNGF, is not clearly understood. This region has been reported to give rise to several bioactive peptides that promote cell survival, probably through activation of Trk receptor pathway.6 Furthermore, binding competition studies suggest that binding sites for NGF prodomain and BDNF prodomain are located in the tunnel of the ten-bladed β-propeller domain of sortilin.7,8

    Net Peptide Content: 100%
    Last update: 12/03/2019

    Recombinant human NGF proDomain protein (#N-290) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use