Free shipping starts now, no minimum, no coupons required!

human proBDNF-Biotin

Biotin-Labeled Human ProBrain-Derived Neurotrophic Factor, Recombinant, E. coli

Cat #: B-257-B
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Recombinant, E. coli
    Source Recombinant, E. coli
    MW: ~51.8 kDa
    Purity: >98%
    Form Lyophilized Powder
    Effective concentration 0.1-10 nM
    Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (shown in bold is the prodomain).
    Label LC-Biotin
    Structure
    Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
    References-Activity
    1. Tolkovsky, A. (1997) Trends Neurosci20, 1.
    2. Jing, S. et al. (1992) Neuron 9, 1067.
    3. Acheson, A. et al. (1995) Nature 374, 450.
    4. Morse, J.K. et al. (1993) J. Neurosci13, 4146.
    5. Hyman, C. et al. (1991) Nature 350, 230.
    6. Friedman, B. et al. (1995) J. Neurosci15, 1044.
    7. Meyer, M. et al. (1992) J. Cell Biol119, 45.
    8. Koliatsos, V.E. et al. (1993) Neuron 10, 359.
    9. Teng, H.K. et al. (2005) J. Neurosci25, 5455.
    10. Woo, N.H. et al. (2005) Nat. Neurosci8, 1069.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
    Solubility Soluble in DDW.
    Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing
    Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C.
    Our bioassay
    • Alomone Labs human proBDNF-Biotin protein mediates ERK1/2 activation in TrkB transfected HEK293 cells.
      Alomone Labs human proBDNF-Biotin protein mediates ERK1/2 activation in TrkB transfected HEK293 cells.
      Transfected cells were serum depleted for 2 h, and then challenged with varying concentrations of Recombinant human proBDNF protein (#B-257) or human BDNF-Biotin (#B-257-B) for 10 minutes. The cell proteins were resolved by SDS-PAGE and detected with anti-phospho-ERK1/2.
    • Alomone Labs proBDNF-Biotin specifically binds avidin.
      Alomone Labs proBDNF-Biotin specifically binds avidin.
      SDS-PAGE resolved purified human proBDNF-Biotin (#B-257-B) specifically binds peroxidase-conjugated avidin, showing a dose-dependent ECL signal at ~25 kDa, absent for the same amount of unlabeled Recombinant human proBDNF protein (#B-257).
    References - Scientific background
    1. Bibel, M. and Barde, Y.A. (2000) Genes Dev14, 2929.
    2. Cahoon-Metzger, S.M. et al. (2001) Dev. Biol232, 246.
    3. Troy, C.M. et al. (2002) J. Biol. Chem277, 34295.
    4. Chen, Z.Y. et al. (2004) J. Neurosci24, 4401.
    5. Egan, M.F. et al. (2003) Cell 112, 257.
    6. Lee, R. et al. (2001) Science 294, 1945.
    7. Teng, H.K. et al. (2005) J. Neurosci25, 5455.
    8. Woo, N.H. et al. (2005) Nat. Neurosci8, 1069.
    9. Fayard, B. et al. (2005) J. Neurosci. Res. 80, 18.
    10. Michalski, B. and Fahnestock, M. (2003) Mol. Brain Res111, 148.
    11. Zhou, X.F. et al. (2004) J. Neurochem91, 704.
    Scientific background

    BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF. The biologically relevant form of the protein was thought to be the mature form, BDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75.2,3

    The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5

    The finding that proBDNF and not mature BDNF is the preferred ligand for p75, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed. It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75 and sortlin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9

    In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9

    Peptide Content: 100%
    Last update: 27/07/2021

    With the many roles allotted to proBDNF, we have developed a novel tool for studying and visualizing the protein in living cells. human proBDNF-Biotin (#B-257-B) is highly purified Recombinant human proBDNF protein (#B-257), conjugated to biotin.

    For research purposes only, not for human use
    Shipping and Ordering information