Noxiustoxin

K+ channel toxin α-KTx 2.1, NTx, Toxin II.11
A Potent Blocker of KV1.2 and KV1.3 Channels
Cat #: STN-340
Alternative Name K+ channel toxin α-KTx 2.1, NTx, Toxin II.11
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Centruroides noxius (Mexican scorpion).
    Source Synthetic peptide
    MW: 4194 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-200 nM.
    Sequence TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN.
    Modifications Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36. Asn39 - C-terminal amidation.
    Molecular formula C174H291N51O55S7.
    CAS No.: 85205-49-8.
    Activity Noxiustoxin inhibits KV1.2 and KV1.3 K+ channels1.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs Noxiustoxin inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.
        Left: Time course of KV1.3 current amplitude in response to test pulses of 100 ms to 0 mV from a holding potential of -100 mV. 200 nM Noxiustoxin (#STN-340) was perfused at the period marked by the horizontal bar. Right: Traces of KV1.3 currents before (red) and during (black) application of Noxiustoxin.
      • Noxiustoxin was originally isolated from the venom of the scorpion Centruroides noxius Hoffmann1 and was shown to interact and inhibit KV1.2 and KV1.3 K+ channels.2 The toxin blocks KV1.3 (recorded using patch clamp in Jurkat cells) with Kd of 6 nM.3 It was shown to bind synaptosomal membranes4 and to increase transmitter release.5 In addition, it was shown to block K+ channels in lymphocytes.6
    Target KV1.2, KV1.3 K+ channels
    Net Peptide Content: 100%
    Last update: 03/04/2019

    Noxiustoxin (#STN-340) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use