Cat #:
STN-340
Alternative Name K+ channel toxin α-KTx 2.1, NTx, Toxin II.11
Lyophilized Powder yes
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Synthetic peptide
MW: 4194 Da
Purity: >98% (HPLC)
Effective concentration 10-200 nM.
Sequence TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN.
Modifications Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36. Asn39 - C-terminal amidation.
Molecular formula C174H291N51O55S7.
CAS No.: 85205-49-8
Activity Noxiustoxin inhibits KV1.2 and KV1.3 K+ channels1.
References-Activity
- Grissmer, S. et. al. (1994) Mol. Pharmacol. 45, 1227.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Noxiustoxin inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.Left: Time course of KV1.3 current amplitude in response to test pulses of 100 ms to 0 mV from a holding potential of -100 mV. 200 nM Noxiustoxin (#STN-340) was perfused at the period marked by the horizontal bar. Right: Traces of KV1.3 currents before (red) and during (black) application of Noxiustoxin.
References - Scientific background
- Possani, L.D. et. al. (1982) Carlsberg Res. Commun. 47, 285.
- Grissmer, S. et. al. (1994) Mol. Pharmacol. 45, 1227.
- Mullmann, T.J. et. al. (2001) Biochemistry 40, 10987.
- Martinez, F. et. al. (1996) Toxicon 34, 1413.
- Stiges, M. et. al. (1986) J. Neurosci. 6, 1570.
- Drakopoulou, E. et. al. (1995) Biochem. Biophys. Res. Commun. 213, 901.
Scientific background Noxiustoxin was originally isolated from the venom of the scorpion Centruroides noxius Hoffmann1 and was shown to interact and inhibit KV1.2 and KV1.3 K+ channels.2 The toxin blocks KV1.3 (recorded using patch clamp in Jurkat cells) with Kd of 6 nM.3 It was shown to bind synaptosomal membranes4 and to increase transmitter release.5 In addition, it was shown to block K+ channels in lymphocytes.6
Target KV1.2, KV1.3 K+ channels
Peptide Content: 100%
Lyophilized Powder
Last update: 02/01/2022
Noxiustoxin (#STN-340) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Citations
Citations
Specifications
Scientific Background
Related Products
Shipping and Ordering information
Resources
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us