Home › Products › Neural Signaling › Neurotransmission › Neurotoxins › Excitatory Neurotoxins

Pardaxin

Pardaxin P-5, Pardaxin Pa5
An Inducer of Neurotransmitter Release
    Cat #: P-300
    Alternative Name Pardaxin P-5, Pardaxin Pa5
  • Lyophilized Powder
  • Bioassay Tested
    • Origin Natural peptide isolated from Pardachirus marmoratus (Red sea moses sole).
    MW: 3382 Da.
    Purity: >98% (HPLC)
    Effective concentration 1-10 µM.
    Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE.
    Molecular formula C156H250N36O47.
    Activity Pardaxin forms ion channel-like structures at low concentrations and at high concentrations, causes cell membrane lysis1,2. Pardaxin also induces neurotransmitter release from neurons3,4.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • The activity of this lot was tested to confirm its ability to stimulate release of catecholamines from PC12 cells according to Lazarovici, P. et al.2.
    References - Scientific background

      • Pardaxin is a 33 amino acid peptidyl toxin, produced by the Red Sea Moses sole fish Pardachirus marmoratus. Pardaxin is acidic, amphipathic, and hydrophobic that forms voltage-dependent pore channels in liposomes and planar lipid bilayers and living cells2.

        The toxin exhibits a neurotoxic, excitatory activity toward neurons at subcytotoxic concentrations by both Ca2+-dependent and Ca2+-independent mechanisms. Pardaxin also causes hemolysis, reduction of blood pressure, cell death by necrosis, and is lethal to rats at higher concentrations3.

    Net Peptide Content: 100%
    Lyophilized Powder
    Last update: 04/11/2019

    Pardaxin (#P-300) is a highly pure, natural, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products