Free shipping starts now, no minimum, no coupons required!
Home › Products › Neural Signaling › Neurotransmission › Neurotoxins › Excitatory Neurotoxins

Pardaxin

Pardaxin P-5, Pardaxin Pa5

An Inducer of Neurotransmitter Release

Cat #: P-300
Alternative Name Pardaxin P-5, Pardaxin Pa5
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Natural peptide isolated from Pardachirus marmoratus (Red sea moses sole).
    MW: 3382 Da
    Purity: >98% (HPLC)
    Effective concentration 1-10 µM.
    Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE.
    Molecular formula C156H250N36O47.
    CAS No.: 67995-63-5.
    Activity Pardaxin forms ion channel-like structures at low concentrations and at high concentrations, causes cell membrane lysis1,2. Pardaxin also induces neurotransmitter release from neurons3,4.
    References-Activity
    1. Lazarovici, P. et al. (1986) J. Biol. Chem. 261, 16704.
    2. Adermann, K. et al. (1998) FEBS Lett. 435, 173.
    3. Abu-Raya, S. et al. (1998) J. Pharmacol. Exp. Ther. 287, 889.
    4. Bloch-Shilderman, E. et al. (2002) J. Pharmacol. Exp. Ther. 301, 953.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • The activity of this lot was tested to confirm its ability to stimulate release of catecholamines from PC12 cells according to Lazarovici, P. et al.2.
    References - Scientific background
    1. Lazarovici, P. et al.(1986) J. Biol. Chem. 261, 16704.
    2. Lazarovici, P. et al.(1992) J. Pharmacol. Exp. Ther. 263, 1317.
    3. Shai, Y. (1994) Toxicology. 87, 109.
    Scientific background

    Pardaxin is a 33 amino acid peptidyl toxin, produced by the Red Sea Moses sole fish Pardachirus marmoratus. Pardaxin is acidic, amphipathic, and hydrophobic that forms voltage-dependent pore channels in liposomes and planar lipid bilayers and living cells2.

    The toxin exhibits a neurotoxic, excitatory activity toward neurons at subcytotoxic concentrations by both Ca2+-dependent and Ca2+-independent mechanisms. Pardaxin also causes hemolysis, reduction of blood pressure, cell death by necrosis, and is lethal to rats at higher concentrations3.

    Peptide Content: 100%
    Lyophilized Powder
    Last update: 02/01/2022

    Pardaxin (#P-300) is a highly pure, natural, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use

    Applications

    Citations

    Specifications

    Scientific Background

    Related Products

    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us