Overview
Cat #:
P-300
Alternative Name Pardaxin P-5, Pardaxin Pa5
Lyophilized Powder yes
Origin Natural peptide isolated from Pardachirus marmoratus (Red sea moses sole).
MW: 3382 Da
Purity: >98% (HPLC)
Effective concentration 1-10 µM.
Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE.
Molecular formula C156H250N36O47.
CAS No.: 67995-63-5.
Activity Pardaxin forms ion channel-like structures at low concentrations and at high concentrations, causes cell membrane lysis1,2. Pardaxin also induces neurotransmitter release from neurons3,4.
References-Activity
- Lazarovici, P. et al. (1986) J. Biol. Chem. 261, 16704.
- Adermann, K. et al. (1998) FEBS Lett. 435, 173.
- Abu-Raya, S. et al. (1998) J. Pharmacol. Exp. Ther. 287, 889.
- Bloch-Shilderman, E. et al. (2002) J. Pharmacol. Exp. Ther. 301, 953.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
- The activity of this lot was tested to confirm its ability to stimulate release of catecholamines from PC12 cells according to Lazarovici, P. et al.2.
Scientific background
Pardaxin is a 33 amino acid peptidyl toxin, produced by the Red Sea Moses sole fish Pardachirus marmoratus. Pardaxin is acidic, amphipathic, and hydrophobic that forms voltage-dependent pore channels in liposomes and planar lipid bilayers and living cells2.
The toxin exhibits a neurotoxic, excitatory activity toward neurons at subcytotoxic concentrations by both Ca2+-dependent and Ca2+-independent mechanisms. Pardaxin also causes hemolysis, reduction of blood pressure, cell death by necrosis, and is lethal to rats at higher concentrations3.
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations