Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

Postsynaptic Marker Antibody Kit

A Screening Package of Postsynaptic Marker Antibodies Economically Priced

Cat #: AK-236
Size: 16 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-Neuroligin 1 (extracellular) Antibody Cat #: ANR-035

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)KVPSTDITLRPTRK, corresponding to amino acid residues 648-661 of rat NLGN1 (Accession Q62765). Extracellular, N-terminus.
Homology
Mouse – identical; human - 13/14 amino acid residues identical.

Neuroligin 1 (extracellular) Blocking Peptide Cat #: BLP-NR035

Size: 40 µg

Anti-Neuroligin 2 (extracellular) Antibody Cat #: ANR-036

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)DLGPRAYDRFPGDS, corresponding to amino acid residues 657-670 of rat NLGN2 (Accession Q62888). Extracellular, N-terminus.
Homology
Mouse - identical; human - 12/14 amino acid residues identical.

Neuroligin 2 (extracellular) Blocking Peptide Cat #: BLP-NR036

Size: 40 µg

Anti-PSD-95 Antibody Cat #: APZ-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KDWGSSSGSQGRED, corresponding to amino acid residues 505-518 of human PSD-95 (Accession P78352). Intracellular, between the SH3 and the GK-like domains.
Homology
Rat, mouse – identical.

PSD-95 Blocking Peptide Cat #: BLP-PZ009

Size: 40 µg

Anti-SAP102 Antibody Cat #: APZ-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: R
Immunogen
GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 (Accession Q92796). N-terminal part.
Homology
Rat, mouse - 26/32 amino acid residues identical.

SAP102 Blocking Peptide Cat #: BLP-PZ003

Size: 50 µg

Anti-Shank1 Antibody Cat #: APZ-011

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)RSQEGRQESRSDKAK, corresponding to amino acid residues 614-628 of rat Shank1 (Accession Q9WV48). Intracellular, between the SH3 and PDZ domains.
Homology
Mouse - identical; human - 13/15 amino acid residues identical.

Shank1 Blocking Peptide Cat #: BLP-PZ011

Size: 40 µg

Anti-Shank3 Antibody Cat #: APZ-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EKLPGSLRKGIPRTK, corresponding to amino acid residues 841-855 of rat Shank3 (Accession Q9JLU4). Intracellular, between the PDZ and the SAM domains.
Homology
Mouse, human - identical.

Shank3 Blocking Peptide Cat #: BLP-PZ013

Size: 40 µg

Anti-Homer1 Antibody Cat #: APZ-026

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KQEIDNARELQEQR, corresponding to amino acid residues 293-296 of rat Homer1 (Accession Q9Z214). Intracellular.
Homology
Mouse, human – identical.

Homer1 Blocking Peptide Cat #: BLP-PZ026

Size: 40 µg

Anti-Gephyrin Antibody Cat #: AIP-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RDAIVKVKEVHDE, corresponding to amino acid residues 183-195 of rat Gephyrin (Accession Q03555). Intracellular.
Homology
Mouse, human – identical.

Gephyrin Blocking Peptide Cat #: BLP-IP005

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information