Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

Presynaptic Marker Antibody Kit

A Screening Package of Presynaptic Marker Antibodies Economically Priced

Cat #: AK-235
Size: 11 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-Neurexin 3α (extracellular) Antibody Cat #: ANR-033

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RYLRWDASTRSDLS, corresponding to amino acid residues 39-52 of rat Nrxn3α (Accession Q07310). Extracellular, N-terminus.
Homology
Mouse, human - identical.

Anti-SNAP-25 Antibody Cat #: ANR-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG, corresponding to the full-length of rat SNAP-25 (Accession P60881). Cytoplasmic.
Homology
Human, mouse - identical.

Anti-Synapsin I (SYN1) Antibody Cat #: ANR-014

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RLHKKLGTEEFP(G), corresponding to amino acid residues 234 - 245 of rat Synapsin-1 (Accession P09951). Intracellular, region C.
Homology
Mouse, human – identical.

Anti-Synapsin II (SYN2) Antibody Cat #: ANR-015

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)SGTLKEPDSSKTP, corresponding to amino acid residues 438-450 of rat Synapsin-2 (Accession Q63537). Intracellular, region G.
Homology
Mouse – identical; human- 12/13 amino acid residues identical.

Anti-Synaptophysin Antibody Cat #: ANR-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide CRQTGNT(S)KELRD, corresponding to amino acid residues 178-190 of rat synaptophysin (Accession P07825). 2nd intravesicular loop.
Homology
Rat, mouse, human - 12/13 amino acid residues identical.

Anti-Synaptotagmin-1 (SYT1) Antibody Cat #: ANR-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide MVSASHPEALAAPVTTVAT(C), corresponding to amino acid residues 1-19 of rat synaptotagmin 1 (Accession P21107). Intravesicular, N-terminus.
Homology
Mouse - 18/19 amino acid residues identical; human, bovine - 17/20 amino acid residues identical; chicken - 15/19 amino acid residues identical.

Anti-Syntaxin 1 Antibody Cat #: ANR-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A (Accession P32851). Intracellular, N-terminus.
Homology
Human, mouse- 264/265 amino acid residues identical.

Anti-VAMP-2 Antibody Cat #: ANR-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence SATAATVPPAAPAGEGGPPAPPPNLT, corresponding to amino acid residues 2-27 of rat VAMP2 (Accession P63045). Cytoplasmic, N-terminus.
Homology
Human, bovine, Macaca mulata - 25/26 amino acid residues identical.

Anti-Vesicular GABA Transporter (VGAT) Antibody Cat #: AGT-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)GEFGGHDKPKITAWE, corresponding to amino acid residues 106-120 of rat vesicular GABA transporter (Accession O35458). Cytoplasmic, N-terminus.
Homology
Mouse, human - identical.

Anti-VGLUT1 Antibody Cat #: AGC-035

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EFRQEEFRKLAGR, corresponding to amino acid residues 2-14 of rat VGLUT1 (Accession Q62634). Cytoplasmic, N-terminus.
Homology
Mouse, human  – identical.

Anti-GAP43 Antibody Cat #: ANR-016

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)KPKESARQDEGKED, corresponding to amino acid residues 205-218 of rat GAP43 (Accession P07936). C-terminus.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information