Calcicludine

CAC
A Blocker of Neuronal L-Type CaV Channels
    Cat #: SPC-650
  • Lyophilized Powder
  • Bioassay Tested
  • Shipped at Room Temp.
  • 100% Net Peptide
  • Origin Dendroaspis angusticeps (Eastern green mamba snake).
    Source Synthetic peptide
    MW: 6979 Da.
    Purity: >98% (HPLC)
    Formulation Lyophilized powder.
    Effective concentration 500 nM.
    Sequence WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK.
    Modifications Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53.
    Structure
    Molecular formula C321H476N86O78S6.
    CAS No.: 178037-96-2.
    Activity Calcicludine is a potent and specific antagonist of neuronal L-type CaV channels1.
    Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Reconstitution Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage after reconstitution Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    Alomone Labs Calcicludine inhibits CaV1.2 channel currents heterologously expressed in Xenopus oocytes.
    A. Representative time course of Calcicludine (#SPC-650) inhibition of CaV1.2 channels current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by application of 500 nM Calcicludine (green). B. Superimposed traces of CaV1.2 current following application of control (black) and of 500 nM Calcicludine (green), taken from the recording in A.
    References
    1. Schweitz, H. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 878.
    2. Stotz, S.C. et al. (2000) J. Membr. Biol174, 157.
    Scientific background

    Calcicludine is a natural peptide isolated from the Dendroaspis angusticepsgreen mamba venom by a modification to the procedure of Schweitz et al.1 and purified to homogenity.

    Calcicludine was shown to be a specific neuronal L-type Cachannel blocker and was shown to inhibit other neuronal HVA Cachannels (N- and P-type) as well.1 1 µM Calcicludine had no effect on skeletal muscle Cachannels (CaV1.1) as well as on T-type (CaV3) channels in heart and neurons.1 Calcicludine was tested to confirm its ability to block spontaneous or K+-induced contraction of cardiac cells.1 It blocked CaV1.2 cloned channels with an IC50 of 88 nM and had very little effect on CaV2 family channels.2 In addition, the block was irreversible upon wash and never complete but reached a maximum of 58%.

    Target L-type Ca2+ channels
    Net Peptide Content: 100%
    Last update: 15/11/2018

    Calcicludine (#SPC-650) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use