Overview
Type: GST fusion protein
Form: Lyophilized powder
Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013) is the original antigen used for immunization during Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) generation. The blocking peptide binds and ‘blocks’ Anti-Cav1.2a/CACNA1C primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat heart membranes:1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).
2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013).
Expression of CaV1.2a in rat heartImmunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).- Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
Properties
Sequence
- GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381).
Accession (Uniprot) Number P15381
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
