Overview
Type: GST fusion protein
Form: Lyophilized powder
Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013) is the original antigen used for immunization during Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) generation. The blocking peptide binds and ‘blocks’ Anti-Cav1.2a/CACNA1C primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat heart membranes:1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).
2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013).
Expression of CaV1.2a in rat heartImmunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).- Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
Properties
Sequence
- GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381).
Accession (Uniprot) Number P15381
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
