Lyophilized Powder This product is freeze dried. All water molecules have been removed.
Antigen Incl. This antibody is shipped with its antigen FREE of charge!
- GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Western blot analysis of rat heart membranes:1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).
2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with the control peptide antigen.
- Mouse brain homogenates (5 µg), (Garau, G. et al. (2015) Exp. Neurol. 274, 156.)
Expression of CaV1.2a in rat heartImmunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).- Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
- c-kit+ cells from mouse bone marrow (Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.).
- Catterall, W.A. et al. (2003) Pharmacol. Rev. 55, 579.
- IUPHAR
- Hu, X.Q. et al. (1998) J. Biol. Chem. 273, 5337.
- Kreuzberg, U. et al. (2000) Am J. Physiol. 278, H723.
- Allard, B. et al. (2000) J. Biol. Chem. 275, 25556.
- Keef, K.D. et al. (2001) Am. J. Physiol. 281, C1743.
All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.
While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).
There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.
Expression of CaV1.2 in human heart.Immunohistochemical staining of human heart sections using Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2 staining (green) shows moderate co-localization with ryanodine receptor staining (red).Adapted from Crossman, D.J. et al. (2011) PLoS ONE 6, e17901. with permission of PLoS.
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rabbit CaV1.2a channel. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize CaV1.2a from mouse, rat and human samples.
Applications
Specifications
Scientific Background
Citations
- Transfected CHO-K1 cells.
Garau, G. et al. (2015) Exp. Neurol. 274, 156.
- Mouse brain homogenates (5 µg).
Garau, G. et al. (2015) Exp. Neurol. 274, 156.
- Human cardiac tissue.
Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.
- c-kit+ cells from mouse bone marrow.
Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.
- Wang, X.T. et al. (2000) Am. J. Pathol. 157, 1549.
- Shistik E. et al. (1999) J. Biol. Chem. 274, 31145.
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us
