Anti-CaV1.2a (CACNA1C) Antibody

Cardiac type α1C
    Cat #: ACC-013
    Alternative Name Cardiac type α1C
  • Lyophilized Powder
  • Antigen Incl.
  • Type: Polyclonal
    Host: Rabbit
    Reactivity: h, m, r
      • GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
        Anti-CaV1.2a (CACNA1C) Antibody
    Accession (Uniprot) Number P15381
    Gene ID 100101555
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Rat, guinea pig - 31/46 amino acid residues identical.
    RRID AB_2039773.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
    Isotype Rabbit IgG.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.95 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Negative control antigen storage before reconstitution Lyophilized powder can be stored intact at room temperature for 2 weeks. For longer periods, it should be stored at -20°C.
    Negative control antigen reconstitution 100 μl PBS.
    Negative control antigen storage after reconstitution -20°C.
    Preadsorption Control 3 µg fusion protein per 1 µg antibody.
    Standard quality control of each lot Western blot analysis.
    Applications: ic, if, ih, ip, wb
    May also work in: ifc*
      • Anti-CaV1.2a (CACNA1C) Antibody
        Western blot analysis of rat heart membranes:
        1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).   
        2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with the control peptide antigen.
      • Mouse brain homogenates (5 µg), (Garau, G. et al. (2015) Exp. Neurol. 274, 156.)
      • Anti-CaV1.2a (CACNA1C) Antibody
        Expression of CaV1.2a in rat heart
        Immunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).
        Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
      • c-kit+ cells from mouse bone marrow (Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.).
      • All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.

        While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).

        There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Image & Title:

    Anti-Cav1.2a (CACNA1C) Antibody
    Expression of CaV1.2 in human heart.Immunohistochemical staining of human heart sections using Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2 staining (green) shows moderate co-localization with ryanodine receptor staining (red).Adapted from Crossman, D.J. et al. (2011) PLoS ONE 6, e17901. with permission of PLoS.

    Last update: 10/11/2019

    Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rabbit CaV1.2a channel. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize CaV1.2a from mouse, rat and human samples.

    For research purposes only, not for human use
      • Transfected CHO-K1 cells.
        Garau, G. et al. (2015) Exp. Neurol. 274, 156.
      • Mouse brain homogenates (5 µg).
        Garau, G. et al. (2015) Exp. Neurol. 274, 156.
      • c-kit+ cells from mouse bone marrow.
        Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.
      • Wang, X.T. et al. (2000) Am. J. Pathol. 157, 1549.
      • Shistik E. et al. (1999) J. Biol. Chem. 274, 31145.
    Related Products
        • Anti-CaV1.2 (CACNA1C)-ATTO-488 Antibody antibody (#ACC-003-AG).
          A fluorescent labeled primary antibody. It can be used in immuno-colocalization studies in conjunction with any of our antibodies raised in rabbit.
        • Guinea pig Anti-CaV1.2 (CACNA1C) Antibody (#AGP-001) is raised in guinea pig and can be used in immuno-colocalization studies in conjunction with any of our antibodies raised in rabbit. This antibody has been raised against the same epitope as that of #ACC-003.