Ceratotoxin-1

β-Theraphotoxin-Cm1a, β-TRTX-Cm1a, CcoTx1
A Blocker of NaV channels
    Cat #: STC-680
    Alternative Name β-Theraphotoxin-Cm1a, β-TRTX-Cm1a, CcoTx1
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4044 Da.
    Purity: >99% (HPLC)
    Effective concentration 1-900 nM.
    Sequence DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29. Leu33 - C-terminal amidation.
      • Ceratotoxin-1
    Molecular formula C172H256N52O50S6.
    Activity Ceratotoxin-1 is a NaV channel blocker1.
      • Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Ceratotoxin-1
        Alomone Labs Ceratotoxin-1 blocks NaV1.2 currents heterologously expressed in Xenopus oocytes.
        A. Time course of Ceratotoxin-1 (#STC-680) action on maximum current NaV1.2 amplitude. Maximum peak current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage step to -10 mV. 200 nM Ceratotoxin-1 was perfused as indicated by the bar (green) for 200 sec. B. Superimposed examples of NaV1.2 channel peak current in the absence (control) and presence (green) of 200 nM Ceratotoxin-1(taken from the experiment in A).
    References - Scientific background
      • There are currently nine types of voltage-gated Na+ (NaV) channels defined and characterized. The channels are responsible for propagation and the creation of action potential in excitable cells1. The channel is comprised of the main α subunit and the β auxiliary subunits. Although the α subunit is sufficient for channel expression it is the β subunit that modifies the kinetics and voltage dependency of the channel. The α subunits are organized in four homologous domains (I-IV) each containing six transmembrane α helices (S1-S6)2.

        Ceratotoxin-1 (β-theraphotoxin-Cm1a, β-TRTX-Cm1a, CcoTx1) is a NaV channel blocker. This peptide toxin was originally isolated from the spider species Ceratogyrus marshalli (Straighthorned baboon tarantula). The toxin binds to all NaV channels in the central nervous system apart from NaV1.33. Mice injected with 500 pmol of Ceratotoxin-1 exhibited symptoms of neurological toxicity in the form of difficulty of standing, breathing reduction and flaccid paralysis. Ceratotoxin-1 also decreases Na+ influx in NaV1.1, NaV1.2, NaV1.4. It is especially selective for NaV1.2 with an IC50 value of 3±1 nM3.

    Target NaV channels
    Net Peptide Content: 100%
    Last update: 24/01/2020

    Ceratotoxin-1 (#STC-680) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use