Overview
Cat #: BLP-CL001
Type: GST fusion protein
Form: Lyophilized powder
CLC-3/CLCN3 Blocking Peptide (#BLP-CL001) is the original antigen used for immunization during Anti-CLC-3 (CLCN3) Antibody (#ACL-001) generation. The blocking peptide binds and ‘blocks’ Anti-CLC-3/CLCN3 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
Application key:
WB-western blot, IHC-Immunohistochemistry
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat brain membranes:1. Anti-CLC-3 (CLCN3) Antibody (#ACL-001), (1:200).
2. Anti-CLC-3 (CLCN3) Antibody, preincubated with CLC-3/CLCN3 Blocking peptide (#BLP-CL001). - Western blot analysis of membranes from Xenopus oocytes, expressing CLC-3, CLC-4, and CLC-5, using Anti-CLC-3 (CLCN3) Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld, University of Nice).
- Rat brain sections (1:100) (Farmer, L.M. et al. (2013) J. Physiol. 591, 1001.).
Properties
Sequence
- GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3 (Accession P51792).
Accession (Uniprot) Number P51792
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Related Products
Related Products
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us