Overview
Cat #: BLP-CL001
Type: GST fusion protein
Form: Lyophilized powder
CLC-3/CLCN3 Blocking Peptide (#BLP-CL001) is the original antigen used for immunization during Anti-CLC-3 (CLCN3) Antibody (#ACL-001) generation. The blocking peptide binds and ‘blocks’ Anti-CLC-3/CLCN3 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only, not for human use
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat brain membranes:1. Anti-CLC-3 (CLCN3) Antibody (#ACL-001), (1:200).
2. Anti-CLC-3 (CLCN3) Antibody, preincubated with CLC-3/CLCN3 Blocking peptide (#BLP-CL001). - Western blot analysis of membranes from Xenopus oocytes, expressing CLC-3, CLC-4, and CLC-5, using Anti-CLC-3 (CLCN3) Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld, University of Nice).
- Rat brain sections (1:100) (Farmer, L.M. et al. (2013) J. Physiol. 591, 1001.).
Properties
Sequence
- GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3 (Accession P51792).
Accession (Uniprot) Number P51792
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.